Comments by Calilasseia

Go to: Not All Those Who Question Evolution Are Creationists

Calilasseia's Avatar Jump to comment 114 by Calilasseia

So you say you're not a creationist, but erect tired and familiar creationist canards to try and dismiss vald evolutionary science? Why do I find your sincerity wholly underwhelming here?

Let's start with so-called "irreducible complexity", shall we?

First of all, let's dismiss the canard that this was alighted upon by Michael Behe. It wasn't. He simply stole the concept, and tried to present it as a purported "problem" for evolutionary biology. Which becomes hilarious when you realise that the evolutionary biologist Hermann Joseph Müller alighted upon the idea of "irreducibly complex" structures not as a "problem" for evolutionary biology, but as a natural outcome of evolutionary processes. Here's how it works: it's called the Müllerian Two Step.

Step 1: Add a component;

Step 2: Make it necessary.

Indeed, Müller introduced this concept way back in 1918, and did so in the following scientific paper:

Genetic Variability, Twin Hybrids and Constant Hybrids in a Case of Balanced Lethal Factors by Hermann Joseph Müller, Genetics, 3(5): 422-499 (1918)

Here's the relevant quote from pages 465 and 466 of this paper, with the apposite part highlighted in boldface:

Most present-day animals are the result of a long process of evolution, in which at least thousands of mutations must have taken place. Each new mutant in turn must have derived its survival value from the effect upon which it produced upon the 'reaction system' that had been brought into being by the many previously formed factors in cooperation; thus, a complicated machine was gradually built up whose effective working was dependent upon the interlocking action of very numerous different elementary parts or factors, and many of the characters and factors which, when new, were originally merely an asset finally became necessary because other necessary characters and factors had subsequently become changed so as to be dependent upon the former. It must result, in consequence, that a dropping out of, or even a slight change in any one of these parts is very likely to disturb fatally the whole machinery

This was placed upon a rigorous footing by the 1930s, and evolutionary biologists refer to this in modern parlance using the term bricolage. Thus, Behe's canards were known to be canards by evolutionary biologists since before Behe was born.

Meanwhile, structures such as the eye and the bacterial flagellum didn't come into existence through random mutation alone - indeed, the omission of selection is another familiar creationist canard. Nick Matzke has not only published a paper in which he predicted that specific homologies would be found between flagellar proteins and those of antecedent systems, but also published a paper in which he presented a model for the selection of the relevant components. Indeed, I think it's worth reviewing the literature on the bacterial flagellum in detail, just to establish how much scientists actually do know about this structure, knowledge which would never have been acquired if they had followed Behe's lead and said "Magic Man did it, don't bother asking questions". So, sit down, and prepare for a long read, because I'm going to take you through about a dozen papers on the subject. Sitting comfortably? Good, I'll begin.

Those nice people over at TalkRational pointed me to a very interesting blog. Namely the blog of Mark Pallen, who was co-author with Nick Matzke of at least one peer reviewed paper in Nature] on the bacterial flagellum (and indeed probably wrote more - I just happen to be aware of the one I have saved to my hard drive). That paper is the following one:

From The Origin Of Species To The Origin Of Bacterial Flagella by Mark J. Pallen & Nicholas J. Matzke, Nature Reviews Microbiology, 4(10): 784-790 (October 2006).

I shall return to this paper shortly, but first, a little preamble is needed.

For those unfamiliar with the background, Nick Matzke was the author of an interesting article, namely this one, which hypothesised that the various proteins that are found in the bacterial flagellum would be found to be homologous with other proteins belonging to other metabolic systems, and that as a consequence, the bacterial flagellum would eventually be found to be the result of co-opting existing, earlier systems and re-using them for another purpose - a classic evolutionary process. Needless to say, a lot of noise was emitted by the ID brigade to the effect that Matzke's ideas were "speculation", and the rest of it, but, the point here is that Matzke made testable predictions in his article, and in doing so provided evolutionary biologists with real substance that they could pursue in the laboratory. The following quote from the abstract of Matzke's original paper is apposite:

A new model is proposed based on two major arguments. First, analysis of dispersal at low Reynolds numbers indicates that even very crude motility can be beneficial for large bacteria. Second, homologies between flagellar and nonflagellar proteins suggest ancestral systems with functions other than motility. The model consists of six major stages: export apparatus, secretion system, adhesion system, pilus, undirected motility, and taxis-enabled motility. The selectability of each stage is documented using analogies with present-day systems. Conclusions include: (1) There is a strong possibility, previously unrecognized, of further homologies between the type III export apparatus and F1F0-ATP synthetase. (2) Much of the flagellum’s complexity evolved after crude motility was in place, via internal gene duplications and subfunctionalization. (3) Only one major system-level change of function, and four minor shifts of function, need be invoked to explain the origin of the flagellum; this involves five subsystem-level cooption events. (4) The transition between each stage is bridgeable by the evolution of a single new binding site, coupling two pre-existing subsystems, followed by coevolutionary optimization of components. Therefore, like the eye contemplated by Darwin, careful analysis shows that there are no major obstacles to gradual evolution of the flagellum.

Now, note that specific predictions were made with respect to the homologies involved, namely that homologies would be found between flagellar proteins and those of the Type 3 Secretory System, plus an enzyme called F1F0-ATP synthetase. I'll leave the latter enzyme aside for a moment, but return to it because this one turns out to play an important role. Stay tuned for the fun revelations!

Now, first of all, the paper from Nature Reviews Microbiology I cited above by Matzke & Pallen itself dispenses wholesale with the idea of the bacterial flagellum being "irreducibly complex", because, lo and behold, there are bacteria with flagella that are missing numerous components. From that paper, I copy the following details with respect to the presence or absence of specific flagellar proteins in various bacteria possessing flagella:

FlgA (P ring) - Absent from Gram-Positive bacteria
FlgBCFG (Rod) - universal
FlgD (Hook) - universal
FlgE (Hook) - universal
FlgH (L Ring) - Absent from Gram-Positive bacteria
FlgI (P Ring) - Absent from Gram-Positive bacteria
FlgJ (Rod) - FlgJ Rod N-terminal domain absent from some systems
FlgK (Hook-Filament Junction) - universal
FlgL (Hook-Filament Junction) - universal
FlgM (Cytoplasm & Exterior) - Absent from Caulobacter
FlgN (Cytoplasm) - Undetectable in some systems
FlhA (T3SS apparatus) - universal
FlhB (T3SS apparatus) - universal
FlhDC (Cytoplasm) - Absent from many systems
FlhE (Unknown) - Mutant retains full motility
FliA (Cytoplasm) - Absent from Caulobacter
FliB (Cytoplasm) - Absent from Escherichia coli
FliC (Filament) - universal
FliD (Filament) - Absent from Caulobacter
FliE (Rod/Basal Body) - universal
FliF (T3SS apparatus) - universal
FliG (Peripheral) - universal
FliH (T3SS apparatus) - Mutant retains some motility
FliI (T3SS apparatus) - universal
FliJ (Cytoplasm) - Undetectable in some systems
FliK (Hook/Basal Body) - universal
FliL (Basal body) - Mutant retains full motility
FliM (T3SS apparatus) - universal
FliN (T3SS apparatus) - universal
FliO (T3SS apparatus) - Undetectable in some systems
FliP (T3SS apparatus) - universal
FliQ (T3SS apparatus) - universal
FliR (T3SS apparatus) - universal
FliS (Cytoplasm) - Absent from Caulobacter
FliT (Cytoplasm) - Absent from many systems
FliZ (Cytoplasm) - Absent from many systems
MotA (Inner membrane) - universal
MotB (Inner membrane) - universal

So, the mere fact that there are in existence bacteria with [i]missing proteins from the above list whose flagella still function[/i] rather makes a mockery of the "irreducible complexity" assertion to begin with. But, this is only part of the story. The same paper continues with the following:

Many paths to motility

Although the evolution by random mutation and natural selection of something as complex as a contemporary bacterial flagellum might, in retrospect, seem highly improbable, it is important to appreciate that probabilities should be assessed by looking forward not back [2]. For example, from studies on protein design it is clear that creating proteins from scratch that, like flagellin, self-assemble into filaments is not very difficult [39,40]. Furthermore, it is clear that there are many other filamentous surface structures in bacteria that show no apparent evolutionary relationship to bacterial flagella [41,42]. In other words, there are plenty of potential starting points for the evolution of a molecular propeller. Evolution of something like the flagellar filament is therefore far less surprising than it might at first seem. In fact, microorganisms have adopted other routes to motility besides the bacterial flagellum [43]. Most strikingly, although archaeal flagella superficially resemble bacterial flagella, in that they too are rotary structures driven by a proton gradient, they are fundamentally distinct from their bacterial counterparts in terms of protein composition and assembly.

Intermediate forms

What about intermediate forms between bacterial flagella and other biological entities? Darwin encountered a similar argument about gaps in the fossil record, and in response he pointed out how improbable fossilization was, so that little of any extinct biosphere could ever be expected to appear in the fossil record [14]. Although fossils are of no use in reconstructing flagellar evolution, similar arguments might be made at the molecular level. Despite a decade of bacterial genome sequencing, we have scarcely begun to sample the molecular diversity of the biosphere. Yet even with the scant coverage of genome sequence data to date, several curiosities have already been revealed. For example, there is growing evidence that flagellin and the flagellar filament are homologous to the NF T3SS protein EspA and the EspA filament, respectively [35,44–48]. The EspA filament therefore provides a model for how the ancestral flagellar filament might have functioned for purposes other than locomotion (adhesion or targeted protein secretion). Furthermore, the EspA protein from E. coli initially seemed to be one of a kind. However, thanks to genome sequencing, related proteins have been identified in several bacteria occupying diverse niches, including: S. typhimurium, Edwardsiella ictaluri, Shewanella baltica, Chromobacterium violaceum, Yersinia frederiksenii, Yersinia bercovieri and Sodalis glossinidius. In addition, proteins that resemble flagellar components but that are encoded in the genomes of bacteria that do not engage in flagellar motility have also been identified. The first example of these potential ‘missing links’ came from the chlamydias [49]. More recently, flagellar-related genes have been detected in the genome of the soil bacterium Myxococcus xanthus, which uses gliding rather than flagellar motility [35]. It seems likely that other examples of potential evolutionary intermediaries will be found as we sequence an increasing proportion of the biosphere.

The paper continues with:

Towards a plausible evolutionary model

From the above discussions of sequence homologies and modularity, it is clear that designing an evolutionary model to account for the origin of the ancestral flagellum requires no great conceptual leap. Instead, one can envisage the ur-flagellum arising from mergers between several modular subsystems: a secretion system built from proteins accreted around an ancient ATPase, a filament built from variants of two initial proteins, a motor built from an ion channel and a chemotaxis apparatus built from pre-existing regulatory domains (FIG. 1). As we have seen, each of these function in a modular fashion and share ancestry with simpler systems — thereby answering the question ‘what use is half a flagellum?’ Furthermore, it is not hard to envisage how an ancestral crude and inefficient flagellum, if it conferred any motility at all, could function as the starting material for natural selection to fashion today’s slicker flagellar apparatus.

However, one could still question how, from such bricolage, natural selection could lock on to an evolutionary trajectory leading to an organelle of motility in the first place, when none of the components alone confer the organism with a selective advantage relevant to motility. The key missing concept here is that of exaptation, in which the function currently performed by a biological system is different from the function performed while the adaptation evolved under earlier pressures of natural selection [50]. For example, a bird’s feathers might have originally arisen in the context of selection for, say, heat control, and only later have been used to assist with flight [51,52]. Under this argument, a number of slight but decisive functional shifts occurred in the evolution of the flagellum, the most recent of which was probably a shift from an organelle of adhesion or targeted secretion, such as the EspA filament, to a curved structure capable of generating a propulsive force.

Now, as a slight tangential diversion, which along the way provides yet more evidence for evolutionary hypotheses, one avenue of attack being considered with respect to the development of the bacterial flagellum is the reconstruction of earlier, more ancient versions of the proteins responsible for the construction of this structure. Precedents already exist with respect to the reconstruction of ancient genes, and the following four papers are examples thereof:

Crystal Structure Of An Ancient Protein: Evolution By Conformational Epistasis by Eric A. Ortlund, Jamie T. Bridgham, Matthew R. Redinbo and Joseph W. Thornton, Science, 317: 1544-1548 (14 September 2007)

Resurrecting Ancient Genes: Experimental Analysis Of Extinct Molecules by Joseph W. Thornton, Nature Reviews: Genetics, 5: 366-375 (5 May 2004)

Resurrection Of DNA Function In Vivo From An Extinct Genome by Andrew J. Pask, Richard R. Behringer and Marilyn B. Renfree, PLoS One, 3(5): e2240 (online version, May 2008)

The Past As The Key To The Present: Resurrection Of Ancient Proteins From Eosinophils by Steven A. Benner, Proc. Natl. Acad. Sci. USA., 99(8): 4760-4761 (16 April 2002)

From the paper by Pask et al above, we have:

There is a burgeoning repository of information available from ancient DNA that can be used to understand how genomes have evolved and to determine the genetic features that defined a particular species. To assess the functional consequences of changes to a genome, a variety of methods are needed to examine extinct DNA function. We isolated a transcriptional enhancer element from the genome of an extinct marsupial, the Tasmanian tiger (Thylacinus cynocephalus or thylacine), obtained from 100 year-old ethanol-fixed tissues from museum collections. We then examined the function of the enhancer in vivo[ Using a transgenic approach, it was possible to resurrect DNA function in transgenic mice. The results demonstrate that the thylacine Col2A1 enhancer directed chondrocyte-specific expression in this extinct mammalian species in the same way as its orthologue does in mice. While other studies have examined extinct coding DNA function in vitro, this is the first example of the restoration of extinct non-coding DNA and examination of its function in vivo. Our method using transgenesis can be used to explore the function of regulatory and protein-coding sequences obtained from any extinct species in an in vivo model system, providing important insights into gene evolution and diversity.

So scientists are [i]already resurrecting ancient proteins and testing their functionality in model organisms[/i]. Indeed, one of the results in the scientific literature comes courtesy of this paper:

Resurrecting The Ancestral Steroid Receptor: Ancient Origin Of Oestrogen Signalling by J.W. Thornton, E. Need and D. Crews, Science, 301: 1714-1717 (2003)

in which the scientists determined that the modern receptors for steroid hormones in modern organisms are traceable to an ancestral receptor dating back 600 million years, and reconstructed the ancestral steroid receptor in the laboratory to determine that it worked.

So, given that precedents already exist for the successful reconstruction of ancient proteins and the genes coding for them, this avenue of attack is likely to prove highly instructive with respect to the bacterial flagellum. Indeed, Pallen & Matzke make this very observation in their paper:

But obviously, one cannot model millions of years of evolution in a few weeks or months. So how might such studies be conducted? One option might be to look back in time. It is feasible to use phylogenetic analyses to reconstruct plausible ancestral sequences of modern-day proteins, and then synthesize and investigate these ancestral proteins. Proof of principle for this approach has already been demonstrated on several NF proteins [69–75]. Similar studies could recreate plausible ancestors for various flagellar components (for example, the common ancestor of flagellins and HAP3 proteins). These proteins could then be reproduced in the laboratory in order to examine their properties (for example, how well they self-assemble into filaments and what those filaments look like). An alternative, more radical, option would be to model flagellar evolution prospectively, for example, by creating random or minimally  constrained libraries and then iteratively selecting proteins that assemble into ever more sophisticated artificial analogues of the flagellar filament. Another experimental option might be to investigate the environmental conditions that favour or disfavour bacterial motility. The fundamental physics involved (diffusion due to Brownian motion) is mathematically tractable, and has already been used to predict, for example, that powered motility is useless in very small bacteria [76,77].

However, let us move on to the more recent developments.

Now,  back in 2006, Pallen & Matzke listed some known homologies, and once again, I reproduce their results from the table in the paper:

FlgA (P ring) - CpaB
FlgBCFG (Rod) - FlgBCEFGK
FlgD (Hook) - none specified
FlgE (Hook) - FlgBCEFGK
FlgH (L Ring) - none yet known
FlgI (P Ring) - none yet known
FlgJ (Rod) - none yet known
FlgK (Hook-Filament Junction) - FlgBCEFGK
FlgL (Hook-Filament Junction) - FliC
FlgM (Cytoplasm & Exterior) - none yet known
FlgN (Cytoplasm) - none yet known
FlhA (T3SS apparatus) - LcrD/YscV
FlhB (T3SS apparatus) - YscU
FlhDC (Cytoplasm) - Other activators
FlhE (Unknown) - none specified
FliA (Cytoplasm) - RpoD, RpoH, RpoS
FliB (Cytoplasm) - none specified
FliC (Filament) - FlgL, EspA
FliD (Filament) - none yet known
FliE (Rod/Basal Body) - none yet known
FliF (T3SS apparatus) - YscJ
FliG (Peripheral) - MgtE
FliH (T3SS apparatus) - YscL, AtpFH
FliI (T3SS apparatus) - YscN, AtpD, Rho
FliJ (Cytoplasm) - YscO
FliK (Hook/Basal Body) - YscI
FliL (Basal body) - none yet known
FliM (T3SS apparatus) - FliN, YscQ
FliN (T3SS apparatus) - FliM, YscQ
FliO (T3SS apparatus) - none
FliP (T3SS apparatus) - YscR
FliQ (T3SS apparatus) - YscS
FliR (T3SS apparatus) - YscT
FliS (Cytoplasm) - none yet known
FliT (Cytoplasm) - none yet known
FliZ (Cytoplasm) - none yet known
MotA (Inner membrane) - ExbB, TolQ
MotB (Inner membrane) - ExbD, TolR, OmpA

Now, as Pallen states in his blog entry as linked above, out of this list of proteins, only two were listed as being both essential to all bacterial flagella AND possessing no known homologues in 2006. Those proteins were FliE and FlgD. From the 2006 update of Matzke's original 2003 paper, we read:

Many of the homologous and/or inessential proteins found in Table 1 of Pallen and Matzke 2006 were cited in the 2003 paper, but the 2006 table is an authoritative update and supercedes what is said here. The important overall point, as discussed in my blog post, is that of the 42 proteins in Table 1 of Pallen and Matzke, only two proteins, FliE and FlgD, are both essential and have no identified homologous proteins. This is substantially more impressive than the situation in 2003, and means that the evidence for the evolutionary origin of the flagellum by standard gene duplication and cooption processes is even stronger than in 2003. Important specific updates include: a homolog of FlgA has been confirmed (along the lines that I suggested in 2003); FliG has no homolog in NF-T3SS or the Exb/Tol systems, rather it may be homologous to the magnesium transporter MgtE; and the flagellar filament protein FliC (and its sister FlgL) is probably homologous to EspA and other pilus proteins found in NF-T3SS. I still suspect that all of the axial proteins (including FliE and FlgD) are homologous to each other and therefore to pilus proteins in NF-T3SS, but only the confirmed homologies are reported in Pallen and Matzke 2006.

At least, this was the situation back in 2006. However, science moves on!

First, take a look at this site, which is the site devoted to ATP synthase. Now, one of the homologies that Matzke originally hypothesised was that at least one of the flagellar proteins would prove to be homologous to proteins in the ATP synthase group, in particular the awkwardly named F1F0-ATP synthetase. Now it turns out that ATP synthases are themselves complex entities, and indeed F1-ATPase rotates on an axis as it performs its synthesis! However, as this paper:

Axle-Less F1-ATPase Rotates In The Correct Direction by Shou Furuike, Mohammad Delawar Hossain, Yasushi Maki, Kengo Adachi, Toshiharu Suzuki, Ayako Kohori, Hiroyasu Itoh, Masasuke Yoshida and Kazuhiko Kinosita, Jr., Science, 319: 955-958 (No. 5865, 15 February 2008)

reveals very succinctly, dismantling this structure so that it no longer has an axle to rotate about does not stop it from functioning! Here's the abstract:

F1–adenosine triphosphatase (ATPase) is an ATP-driven rotary molecular motor in which the central γ subunit rotates inside a cylinder made of three α and three β subunits alternately arranged. The rotor shaft, an antiparallel α-helical coiled coil of the amino and carboxyl termini of the γ subunit, deeply penetrates the central cavity of the stator cylinder. We truncated the shaft step by step until the remaining rotor head would be outside the cavity and simply sat on the concave entrance of the stator orifice. All truncation mutants rotated in the correct direction, implying torque generation, although the average rotary speeds were low and short mutants exhibited moments of irregular motion. Neither a fixed pivot nor a rigid axle was needed for rotation of F1-ATPase.

Another blow to "irreducible complexity" sensu Behe (Hermann Müller would doubtless have smiled wryly over this!), but this isn't all. Returning to Pallen's blog, we find this:

Since the early 1990s, it has been known, from sequence comparisons, that the flagellar ATPase (FliI) is homologous to the alpha and beta subunits of the F-type ATPase, a transmembrane protein complex (see figure) found in bacteria, mitochondria and chloroplasts (see http://www.atpsynthase.info).

In 2003, Nick Matzke (then at the NCSE and so a couple of years later science adviser to the plaintiffs in the Dover trial) wrote an essay summarising plausible evolutionary scenarios for the origin of the bacterial flagellum. He noted a couple of previous suggestions that the proto-flagellum might have originated from the F-type ATPase. Crucially, he predicted that additional homologies would be found between components of the F-type ATPase and the flagellar protein export apparatus, for example between the b subunit of the ATPase and FliH and between the delta subunit and FliJ.

In 2006, I confirmed one of Nick's hunches through homology searches, showing that part of FliH was homologous to the b subunit. However, things turned out slightly different from Nick's predictions in that FliH is actual of a fusion of domains homologous to the b subunit and the delta subunit.

Last year Namba's group published the structure of FliI and confirmed the striking homology with the F-type ATPase enzymatic subunits. At that stage in the game, it had become clear that the ATPase was a universal component not just of flagellar export systems but also of non-flagellar type III secretion systems. Also, if it was also clear that if one knocked out the gene for FliI, one abolished flagellar biosynthesis. Thus, just about everyone in the field accepted that FliI was an essential component of the flagellar apparatus and that it energised secretion of proteins through the protein export system. In other words, if there were anything to the idea, put forward by Behe and others in the ID movement, that the flagellum showed "irreducible complexity", even experts might have accepted that FliI was one of the "irreducible" components!!

BUT earlier this year, Minamino and Namba (and independently a team headed by Kelly Hughes in the US) overturned all our assumptions by showing that it was perfectly possible to make flagella without FliI--what you needed to do was knock out FliH at the same time. Somehow or other FliH, which usually interacts with FliI, gums up the export apparatus in the absence of FliI. So, bang goes another pillar of support for the ID argument! In fact, it appears that flagellar protein export is powered not primarily by the ATPase but by the proton-motive force.

So, the FliI protein appeared on the face of it to be essential, because knocking out the gene for FliI synthesis destroyed flagellar biosynthesis. But, and here's the part that really throws the spanner into "irreducible complexity" as espoused by Behe, if you knock out the gene coding for FliI, but in addition knock out the gene for FliH, flagellar biosynthesis returns! This rather buggers up Behe's version of "irreducible complexity" in a spectacular manner.

Yet even this is not the whole story. Believe it or not, there is more! Returning to Pallen's blog, we read:

Namba and colleagues have now solved the structure of FliJ, another protein that interacts with FliI and FliH. And what they found was clear evidence of homology with yet another protein from the F-type ATPase--the gamma subunit!

So, now we have deep and broad homologies between the flagellum and the F-type ATPase, just as Nick predicted. This provides another nail in the coffin of the idea that flagellum was intelligently designed. If the flagellum were the product of intelligent design, particularly by an omniscient deity, the designer could have custom-built it from scratch, so it need not resemble anything else in nature. By contrast, the processes of evolution tends to cobble together and tweak already existing components (something Francois Jacob called bricolage)--and slowly but steadily it is become clear that the flagellum has been built this way.

Incidentally, the paper covering the homology between FliI and the alpha and beta subunits of the F-type ATPase is this paper:

Salmonella typhimurium Mutants Defective In Flagellar Filament Regrowth And Sequence Similarity Of FliI to F0F1, Vacuolar, And Archaebacterial ATPase Subunits by Alfried P. Vogler, Michio Homma, Vera M. Irikura and Robert M. McNab, Journal of Bacteriology, 173(11): 3564-3572 (June 1991) [Full paper downloadable from here]

so this homology had actually been known even before Behe made his assertions about "irreducible complexity", something he would have known if he had bothered to perform a basic literature search. After all, he has institutional access, whereas I don't currently, yet I was able to find this paper once pointed in the right direction. This paper also covers the knocking out of the gene for FliI and the effect on flagellar biosynthesis.

More pertinently, the following paper:

Evolutionary Links Between FliH/YscL-Like Proteins From Bacterial Type III Secretion Systems And Second-Stalk Components Of The F0F1 And Vacuolar ATPases by Mark J. Pallen, Christopher M. Bailey and Scott A. Beatson, Protein Science, 15: 935-941 (2006) [Full paper downloadable from here]

is the one containing the confirmation by Pallen of one of Matzke's predictions as cited above. Another homology was confirmed courtesy of this paper:

Structural Similarity Between The Flagellar Type III ATPase FliI And F1-ATPase Subunits by Katsumi Imada, Tohru Minamino, Aiko Tahara and Keiichi Namba, Proceedings of the National Academy of Sciences of the USA, 104(2): 485-490 [Full paper downloadable from here]

This paper:

Distinct Roles Of The FliI ATPase And Proton Motive Force In Bacterial Flagellar Protein Export by Tohru Minamino and Keiichi Namba, Nature, 451: 485-489 (24th January 2008) [Full paper downloadable from here]

is the paper that covers the knocking out of FliH and FliI resulting in restoration of flagellar biosynthesis.

So, now the only two proteins remaining to find homologies for are FliE and FlgD, and you can bet that this is being worked upon as I type this.

What was that about "evolution couldn't produce the bacterial flagellum" again? Looks like someone needs to spend time reading some real science instead of creationist websites.

Oh, and as for the "no transitional fossils" canard, allow me to present:

Here's a sequence of fossils covering the tetrapod lineage, namely:

Eusthenopteron ... 385 million years ago
Panderichthys ... 380 million years ago
Tiktaalik ... 375 million years ago
Acanthostega ... 365 million years ago
Ichthyostega ... 362.5 milllion years ago
Hypnerpeton] ... 360 million years ago

Several other taxa have been added since I compiled that list.

Indeed, Tiktaalik was predicted to exist before it was found. Not only was it predicted to exist, but it was predicted to possess specific features and to exist in a particular geological stratum before it was found. Moreover, the fossil was found where it was predicted to exist, and upon detailed examination, was found to possess the precise anatomical features that were predicted in advance by evolutionary biologists and palaeontologists. Here are some nice illustrations of anatomical comparisons (click on links to view):

Comparative anatomy of tetrapods 1

Comparative anatomy of tetrapods 2

So, since scientists knew what to look for in advance, found the fossil of Tiktaalik where it was predicted it would exist, and found that Tiktaalik possessed the anatomical features it was predicted to possess on the basis of it being an intermediate step between earlier creatures and later creatures in the sequence, we can consider this confirmed set of predictions validated by real world evidence to be yet more support for the existence of a sequence of organisms in various stages of development between Rhipidistian fishes and land-dwelling tetrapods, as if, of course, all the other fossils cited above weren't enough to begin with.

Moving on to the theropods, here's a nice list of relevant fossils which exhibit a brace of features that any trained comparative anatomist would regard as "transitional":

Shuvuuia ... 81 million years ago
Protarchaeopteryx ... 122 million years ago
Sinosauropteryx ... 122 million years ago
Sinornithosaurus ... 122 million years ago
Caudipteryx ... 125 million years ago
Beipiaosaurus ... 125 million years ago
Yixianosaurus ... 125 million years ago
Jinfengopteryx ... 125 million years ago
Sinocalliopteryx ... 125 million years ago
Cryptovolans ... 130 million years ago
Dilong ... 130 million years ago
Microraptor ... 130 million years ago
Archaeopteryx ... 155 million years ago
Pedopenna ... 160 million years ago
Epidendrosaurus ... 170-120 million years ago (date yet to be more precisely determined)
Scansoriopteryx ... 170-120 million years ago (date yet to be more precisely determined)

An interesting scientific paper is this one which contains an extensive family tree of theropods and pre-Avian dinosaurs, namely:

A Basal Dromaeosaurid And Size Evolution Preceding Avian Flight by Alan H. Turner, Diego Pol, Julia A. Clarke, Gregroy M. Erickson and Mark A. Noreli, Science, 317: 1378-1381 (7th September 2007)

This paper includes a good number of illustrations of the fossils of a recent discovery among the Dromaeosaurids, namely Mahakala omnogovae - indeed, the paper describes the holotype.

What was that about "no transitional fossils" again?

Oh, and as for the Cambrian pseudo-explosion, this list of scientific papers blows creationist canards about that out of the water with a nuclear depth charge:

Adaptive Walks In A Gene Network Model Of Morphogenesis: Insights Into The Cambrian Explosion by Ricard V. Solé, Pau Fernández and Stuart A. Kauffman, International Journal of Developmental Biology, 47: 685-693 (2003)

Anatomical Information Content In The Ediacaran Fossils And Their Possible Zoological Affinities by Jerzy Dzik, Integrative and Comparative Biology, 43(1): 114-126 (2003)

Bayesian Models Of Episodic Evolution Support A Late Precambrian Explosive Diversification Of The Metazoa by Stéphanie Aris-Brousou and Ziheng Yang, Molecular Biology and Evolution, 2-(12): 1947-1954 (2003)

Before Programs: The Physical Origination Of Multicellular Forms by Stewart A. Newman, Gabor Forgacs and Gerd B. Müller, International Journal of Developmental Biology, 50: 289-299 (2006)

Can Fast Early Rates Reconcile Molecular Dates With The Cambrian Explosion? by L.D. Bromham & M.D. Hendry, Proc. R. Soc. Lond. B 267: 1041-1047 (2000)

Early Animal Evolution: Emerging Views From Comparative Biology And Geology by Andrew H. Knoll and Sean B. Carroll, Science, 284: 2129-2137 (25th June 1999)

Estimating Metazoan Divergence Times With A Molecular Clock by Kevin J. Peterson, Jessica B. Lyons, Kristin S. Nowak, Carter M. Takacs, Matthew J. Wargo & Mark A. McPeek, Proceedings of the National Academy of Science of America, April 2004, 101(17): 6536-6541

Eukaryotic Organisms In Proterozoic Oceans by A. H. Knoll, E. J. Davaux, D. Hewitt and P. COhen, Philosophical Transactions of the Royal Society Part B, 361: 1023-1038 (5th May 2006)

Evolution Of Amino Acid Frequencies In Proteins Over Deep Time: Inferred Order Of Introduction Of Amino Acids Into The Genetic Code by Dawn J. Brooks, Jacques R. Fresco, Arthur M. Lesk, and Mona Singh, Molecular Biology and Evolution 19: 1645-1655 (2002)

Fossils, Molecules And Embryos: New Perspectives On The Cambrian Explosion by J.W. Valentine, D. Jablonski & D.H. Erwin, Development, February 1998, 126(5): 851-859

Inferring The Historical Patterns Of Biological Evolution by Mark Pagel, Nature, 401: 877-884 (28 October 1999)

Interpreting The Earliest Metazoan Fossils: What Can We Learn? by Ben Waggoner, Amer. Zool., 38: 975-982

Lower Cambrian Vertebrates From South China by D-G. Shu, H-L. Lou, S. Conway Morris, X-L. Zhang, S-X. Hu, L. Chen, J. Han, M. Zhu, Y. Li and L-Z. Chen, Nature, 402: 42-46 (4th November 1999)

Major Transitions In Animal Evolution: A Developmental Genetic Perspective by Peter W. H. Holland, American Zoologist, 38: 829-842 (1998)

MicroRNAs And The Advent Of Vertebrate Morphological Complexity by Alysha M. Heimberg, Lorenzo F. Sempre, Vanessa N. Moy, Philip C. J. Donoghue and Kevin J. Peterson, Proceedings of the National Academy of Sciences of the USA, 105(8): 2946-2950 (26th February 2008)

Molecular Phylogeny Of Arthropods And The Significance Of The Cambrian "Explosion" For Molecular Systematics by Jerome C. Regier & Jeffrey W. Schultz, AMER. ZOOL., 38: 918-928 (1998)

On The Eve Of Animal Radiation: Phylogeny, Ecology And Evolution Of The Ediacaran Biota by Shuhai Xiao and Marc Laflamme, Trends in Ecology and Evolution, 24(1): 31-40 (25th October 2008)

Organic Membraneous Skeleton Of The Precambrian Metazoans From Namibia by Jerzy Dzik, Geology, 27(6): 519-522 (June 1999)

Palaeontological Evidence To Date The Tree Of Life by Michael J. Benton and Philip C. J. Donoghue, Molecular and Biological Evolution, 24(1): 26-53 (2007)

Precambrian Sponges With Cellular Structures by Chia-Wen Li, Jun-Yan Chen and Tzu-En Hua, SCIENCE, 279(6): February 1998

Quality Of The Fossil Record Thorugh Time by M.J. Benton, M.A. Wills and R. Hitchin, Nature, 403: 534-537 (3 Feb 2000)

Sr And C Isotopes In Lower Cambrian Carbonates From The Siberian Craton: A Paleoenvironmental Record During The ‘Cambrian Explosion’ by L.A. Derry, M.D. Brasier, R. M. Corfield, A. Yu. Rozanov & A. Yu. Zhuralev, Earth and Planetary Science Letters 128: 671-681 (1994)

Solution To Darwin's Dilemma: Discovery Of The Missing Precambrian Record Of Life by J. William Schopf, Proceedings of the National Academy of Sciences of the USA, 97(13): 6947-6953 (20th June 2000)

Taphonomy And Anatomy Of The Ediacarans by Jerzy Dzik, Geophysical Research Abstracts, 10: EGU2008-A-01357 (2008)

Taxonomic Congruence Versus Total Evidence, And Amniote Phylogeny Inferred From Fossils, Molecules And Morphology by Douglas J. Eernisse and Arnold G. Kluge, Molecular Biology & Evolution, 10(6): 1170-1195 (1993)

Testing The Cambrian Explosion Hypothesis By Using A Molecular Dating Technique by Lindell Bromham, Andrew Rambaut, Richard Fortey, Alan Cooper and David Penny, Proceedings of the National Academy of Science of America, October 1998, 95:[ 12386-12389

The Cambrian "Explosion": Slow Fuse Or Megatonnage? by Simon Conway Morris, Proceedings of the National Academy of Science of America, April 2000, 97(9): 4426-4429

The Cambrian Fossil Record And The Origin Of The Phyla by Graham E. Budd, Integrative & Comparative Biology  43: 157-165 (2003)

The Ediacaran Biotas In Space and Time by Ben Waggoner, Integrative & Comparative Biology, 43: 104-113 (2003)

The Ediacaran Emergence Of Bilaterans: Congruence Between The Genetic And The Geological Fossil Records by Kevin J. Peterson, James A. Cotton, James G. Gehling and Davide Pisani, Philosophical Transactions of the Royal Society Part B, 363: 1435-1443 (11th January 2008)

The Fossil Record Of Early Eukaryotic Diversification by Susannah M. Porter, Palaeontological Society Papers, 10: 35-50 (2004)

The Origin Of The Mineral Skeleton In Chordates by Jerzy Dzik, Evolutionary Biology, 31: 105-154 (2000)

The Timing Of Eukaryotic Evolution: Does A Relaxed Molecular Clock Reconcile Proteins And Fossils? by Emmanuel J.P. Douzery, Elizabeth A. Snell, Eric Bapteste,  Frédéric Delsuc & Hervé Philiipe, Proceedings of the National Academy of Science of America, October 2004, 101(43): 15386-15391

Two-Phase Increase In The Maximum Size Of Life Over 3.5 Billion Years Reflects Biological Innovation And Environmental Opportunity by Jonathan L. Payne, Alison G. Boyer, James H. Brown, Seth Finnegan, Michal Kowalewski, Richard A. Krause Jr., S. Kathleen Lyons, Craig R. McClain, Daniel W. McShea, Philip M. Novack-Gottshall, Felisa A. Smith, Jennifer A. Stempien and Steve C. Wang, Proceedings of the National Academy of Sciences of the USA, 106(1): 24-27 (6th January 2009)

Right, I think that's enough to be going on with. That should keep you in scientific reading matter for about four months. Enjoy. :)

Thu, 20 May 2010 23:38:00 UTC | #471863

Go to: I'm debating an anti-evolutionist and need some answers.

Calilasseia's Avatar Jump to comment 38 by Calilasseia

Comment 36 by AgnosticAlien
 No, I don't think it's him. This guy's from Australia, btw.
That rules out VMartin. He's based in Bratislava.

Mon, 17 May 2010 01:44:19 UTC | #470698

Go to: I'm debating an anti-evolutionist and need some answers.

Calilasseia's Avatar Jump to comment 35 by Calilasseia

Comment 32 by AgnosticAlien
Thanks to everyone for your comments. With the help of your input and the additional research I've been doing, I think I will have a rebuttal ready for my opponent shortly. I should clear up a common misconception that has been posted by many of you here. Although the first person I was debating on the the evolution issue on the Internet forum was a creationist, the person who responded to my latest post(which I presented here) is not a creationist but is an anti-evolutionist. He abhors religion and religious creationists as much as he detests evolutionists. He basically is against any position which HE considers to be othodox or mainstream. This means that in addition to rejecting evolution and religion, he doesn't accept the conclusions reached on other issues such as evolution, global warming, plate tectonics, vaccinations, the dangers of second-hand smoke, well, you get the picture. The only way to effectively debate this guy is to have a very solid argument based on logic and strong evidence.

This guy wouldn't happen to be VMartin by any chance? Only he was an interesting character in the old days. He's a fanboy of John A. Davison, and both of these characters feature in PZ Myers' killfile page at Pharyngula.

Sun, 16 May 2010 19:56:46 UTC | #470610

Go to: I'm debating an anti-evolutionist and need some answers.

Calilasseia's Avatar Jump to comment 24 by Calilasseia

Ah, what a pity certain  material is no longer available here. Only back in the old days, I posted a lot of posts on this subject, including references to enough scientific papers to blow creationist canards about the Cambrian pseudo-explosion out of the water with a nuclear depth charge, complete with presentation of the contents of several of these. You arrived a little late unfortunately.

Sun, 16 May 2010 11:00:54 UTC | #470467

Go to: Militant Atheism: Why The Gloves Came Off

Calilasseia's Avatar Jump to comment 17 by Calilasseia

I use the word "Militant" in total mockery of the Militant Religionists.  I state emphatically in my blog exactly what Militant Atheism is not.  Militancy, as well, is also used to show that those of us who are as such will no longer put up with being discriminated against and forced to conform in any way to the bullies that are trying to force us to comply with their beliefs, customs and traditions.  As well, we will "fight" to keep religion out of secular society, including it's laws.

 

Al, in response I have to say this.

 

Since the central issue here is that you, I, and others like us want to see policy decisions affecting human beings to be decided upon evidence, and not the blind assertions of old books of myths, and seek to have policy decisions guided by reason instead of superstition, I consider the point I was making to stand. I don't consider vigorous, robust defence of a reality-based position to be "militant".

 

Whilst you may be using the term for satirical reasons, the simple fact is that supernaturalists use this term as an ad hominem, for the specific purpose of shutting down any debate that threatens their cosy assertion-laden, doctrine-based world view. It is this that I have in mind when issuing the statements I do. Genuine militancy within that arena of discourse concerned with the pernicious influence of supernaturalism I have already defined above, and consider that definition to be sound.

Thu, 06 May 2010 20:33:54 UTC | #467348

Go to: Militant Atheism: Why The Gloves Came Off

Calilasseia's Avatar Jump to comment 9 by Calilasseia

My understanding is that atheism consists of nothing more than a refusal to accept uncritically unsupported blind supernaturalist assertions. Exactly how is one suppoed to be "militant" about NOT insisting that blind assertions of dogma constitute established fact? Exactly how is one supposed to be "militant" about NOT regarding said blind assertions as if they constitute supposed "axioms" about the world, regardless of whether or not observational reality agrees with said blind assertions?

 

I always thought militancy consisted of stubborn insistence that reality conforms to ideological presuppositions. Since atheism doesn't have presuppositions, the application of "militancy" is therefore null and void. Not accepting uncritically blind assertions doesn't equal presuppositions, in case anyone is unaware of this elementary concept.

 

Wed, 05 May 2010 23:15:56 UTC | #467061

Go to: Kent Hovind's Doctoral Dissertation

Calilasseia's Avatar Jump to comment 97 by Calilasseia

I have yet to read this turgid example of supernaturalist intellectual faeces, though I have downloaded it for later reading at my leisure, and already I am beginning to wonder who I should file a claim against for the lost hours of my life, if I embark upon the task of reading this suppuratingly gangrenous and encephalitic little screed.

I have known for some time that Hovind is rampantly dishonest, indeed that he was so even before his laughable attempt to stick the middle finger to the tax authorities and the subsequent jail sentence for tax fraud. I have suspected for some time that he is also recrudescently vulgar and barbarous beneath the thin veneer of entirely synthetic 'respectability' with which he has painted himself, and that he chose the easy route of securing a so-called "Ph.D" from a diploma mill not only because he was too indolent to engage in any genuine academic hard work, but also because at bottom, he actively despises genuine intellectual effort out of spite and envy - indeed, the entire railing against valid science by creationists I have characterised in the past as intellectual penis envy writ large. But until encountering the reviews of this sordid little document by people who have seen its fulminatingly dreadful contents first hand, I never really thought that the man could be a genuine, diagnosable paranoid schizophrenic. A fantasist on an epic scale, certainly, but then quite a few sane people fall into that category, quite a few professional politicians among them. However, if he is genuinely deranged enough to believe any of the categorical statements he has erected in that shabby little piece of typewritten toilet paper, let alone all of them, then I suspect he is truly certifiable.

Once again, the words of Lord Vansittart spring to mind: "A ponderous lightweight".

Fri, 11 Dec 2009 01:55:00 UTC | #422415

Go to: Dembski Exam

Calilasseia's Avatar Jump to comment 15 by Calilasseia

Why does it not surprise me that Dembski force-feeds his students with these tired old canards? And trains them to be yet more pieces of ideological cannon fodder, in his war to see mythology anachronistically re-asserted over valid, evidence-based science?

I've long suspected that this is his revenge for being incompetent in the world of real science. It's all a huge hissy fit arising from intellectual penis envy.

Sun, 09 Aug 2009 08:49:00 UTC | #386388

Go to: Trials Loom for Parents Who Embraced Faith Over Medicine

Calilasseia's Avatar Jump to comment 168 by Calilasseia

Reading all of this, I'm reminded of something that might be apposite.

"Superior orders" was erected by defendants in war crimes trials (including Nuremberg), and that defence was roundly rejected. I therefore contend that a case can be made making the pastor an accessory by virtue of having, in effect, issued orders to the parents that they obeyed unconditionally out of misplaced duty. This does not absolve the parents of responsibility, as they should have known that the 'orders' dispensed were likely to have catastrophic consequences in this instance, but it also provides for a means of extending justice to include what one might think of as a religious version of 'corporate responsibility'. After all, if people can be prosecuted for inflicting financial damage whilst running a corporation, surely this can be extended in the above described manner to religious cults that brainwash their adherents to the point of those adherents committing grossly negligent actions resulting in human deaths?

Thu, 22 Jan 2009 05:41:00 UTC | #310304

Go to: PLEASE WRITE IN SUPPORT OF PZ MYERS

Calilasseia's Avatar Jump to comment 80 by Calilasseia

Here is my contribution, just sent via E-Mail:

Dear Sir,

It has recently been brought to my attention that various individuals have been waging a hate campaign against Professor PZ Myers, tenured at your establishment, all because Professor Myers happened to make remarks on his weblog regarding a wafer biscuit.

Whilst Professor Myers has been robust and resolute in his rejection of the more florid manifestations of doctrine-inspired absurdity, and this naturally has brought him to be regarded as a target figure in the demonology of adherents of doctrine, the latest campaign launched against him is not only utterly vindictive, and says more about the prejudices of those pursuing it than it does about Professor Myers, it demonstrates once again that adherents of doctrine appear to regard themselves as being in the privileged position of being able to shut down freedom of speech whenever someone dares to do other than genuflect before their metaphysical presuppositions, or dares to criticise the absurdities that arise therefrom. This campaign, needless to say, should be treated with the scorn and derision that it manifestly deserves, as it is a blatant attempt to resurrect Inquisitional repression of free speech and free thought, by individuals who apparently see no inconsistency in preaching a religion whose central figure espoused tolerance and pluralism, yet decide on the basis of this religion that they possess the right to suppress the very pluralism purportedly inherent in their beliefs.

By contrast, Professor Myers has been a valuable source of in-depth information, including information on current scientific research in the life sciences, for a wide audience including lay persons spanning across whole continents, writing with a lucid, compelling narrative style that many of his readers would consider to aspire to the same elevated standards of clarity and inspirational exposition of the fascinating nature of the scientific endeavour last seen deployed by Carl Sagan. There are a considerable number of individuals among his large audience, eager for scientific information as seen from the inside, who regard Professor Myers as a worthy successor to that well-known and cherished legacy. He is, for this reason alone, someone that your institution should regard not as a candidate for removal of tenure, but as an asset of immeasurable value with respect not only to the promulgation of valid science, and defence thereof against mendacious and duplicitous attack by individuals with anti-science, anti-progress, anti-learning and anti-knowledge agendas, but with respect to its teaching within the walls of your establishment. If he can write on topics of considerable technical intricacy, in such a manner as to render them not only comprehensible to an international lay audience, but present them as exciting and utterly awe-inspiring reading, then surely his pedagogical value within your establishment is if anything magnified many fold, for how many tenured professors can you name who are thought of in the same light?

I would urge you to dismiss this entirely scurrilous campaign and its anachronistic revival of the mentality that doubtless surrounded the hounding of Galileo 375 years ago, which has no place in the 21st century, and certainly not in a nation that contains explicit statements of separation of church and state in its Constitution.

Yours sincerely,



[real name withheld from the RDF front page]


Hopefully that should suffice. :)

Thu, 10 Jul 2008 16:05:00 UTC | #197560

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 987 by Calilasseia

Sadly most atheists DO NOT want to sincerely and objectively know what the truth is


Total crap.

It is precisely because we don't accept uncriticially the unsupported assertions of worthless doctrines that we are better equipped to find the truth than any number of propagandists for reality-denial masturbation fantasies.

because science has clearly revealed God


Total bollocks.

Science has done no such thing. In fact, if you understood any physics, science has made your invisible magic man superfluous to requirements. But then you don't know any real science, do you, because you've been too busy filling your head with masturbation-fantasy garbage.

and so has His Final revelation the Qu'ran 1400 years ago


Crap. Your worthless book containing the diseased ramblings of a kiddy fiddler is about as scientifically literate as the shit pumped out by AiG and ICR. The only way in which any claims of scientific legitmacy can be made for your book of diseased ramblings is if one engages in apologetic force-fitting of valid science to your doctrine and its presuppositions. Your book of nonsense still puts forward the story of Adam being formed, fully adult, with fully formed adult cognition and fully formed adult language capability, out of a ball of dirt. Scientific fact says something rather different. Or hadn't you noticed this whilst inserting your head into your own rectum and inhaling the stench of doctrine?

and yet they still resist, ignore and not accept the manifest truth - why?


Any idea that the diseased ramblings of a kiddy fiddler who lived before science in its current form even existed constitutes "the manifest truth" is something only the terminally doctrine-addled could assert. Did your kiddy fiddler prophet know about the Navier-Stokes Equations? Did he know about tensor analysis? Did he know about 4D effective theory and its linkage to M-theory? No? Why does that not surprise me in the least?

They have chosen to submit to their own vain and wishful thinking whims and desires.


Total bollocks. We have chosen to listen to REALITY instead of the diseased ramblings of a doctrine.

SCIENCEISLAM.COM


Is a pile of horseshit. It consists of a circle-jerk of apologists constructing convoluted semantic jsutifications for presuppositions that are wholly unsupported by observational reality. What part of "scientific theories are based upon correspondence with observational reality" are you too stupid to understand again?

To Calillasseia,

I am not hitting on anyone


Blatant and manifest lie. Propositioning a female poster constitutes the definition of hitting upon her. What part of this elementary notion are you too stupid to understand again, creep?

but just making a sincere offer to her provided she is not married.


I have news for you. She has better taste. Chances are she considers a seven inch piece of plastic and two 1.5 volt batteries to be a superior choice to you.

Are you jeolous or somethin?!


Jealous of an idiot who is incapable of addressing even the most elementary points put to him?

Jealous of a propagandist for doctrine who demonstrates time and again in his posts that he is scietifically illiterate, ignorant, boorish, palsied and too busy hypnotising himself to the music of the spheres of his own verbal diarrhoea whilst staring glassy-eyed at the doctrinal hologram in his head to be aware of the real world and what it is telling him?

You're fantasising again. Asking if I'm jealous of you is like asking if I'm jealous of someone who emerged from the clap clinic with a positive diagnosis.

I will not let you off the hook, so..


So you're going to post your worthless website again. Yawn. Got anything scientifically valid to post, such as the actual scientific papers that I've posted in the past? Or is your literacy level still too far below crayon to understand their contents?

SCIENCEISLAM.COM


Youre website is a pile of steaming intellectual faeces of the most putrid order. It comprises nothing more than assorted wank-break circle-jerk apologists erecting convoluted semantic justifications for doctrinal presuppositions and retroactively force-fitting valid science to those doctrinal presuppositions. It's about as scientifically valid as Grimm's Fairy Tales.

DO NOT FORGET THAT IT WAS THE MUSLIMS WHO TOOK EUROPE OUT OF THEIR DARK AGES AND ORIGINATED THE SCIENCES


Bollocks. All that the early muslims did was preserve the earlier works of Classical Greek civilisation.

Then, the muslim world disappeared up its own doctrinal rectum when it decided that conformity to a doctrine mattered more than correspondence with observational reality. Which is why islamic nations today are backward shit holes, several of which are only propped up by oil money, and without which, they would have reverted to the primeval slime years ago.

AND HOW IT WAS THE BOOK OF GOD , THE QU'RAN THAT INSPIRED IT ALL


Bollocks. Your diseased book of kiddy fiddler ramblings inspired only one thing - the abandonment of appreciation of reality in favour of conformity to doctrine based upon myth and fantasy. Which is why islamic nations are backward shit holes.

But just like the false teaching of evolution in academia you were deliberately not told about it.


Actually my history classes dealt a fair amount with the early years of the muslim world, and listed the contributions it made at a time when it had the courage to listen to reality. Unfortunately, it stopped listening to reality and instead turned to conformity to doctrine, and disappeared up its own rectal passage as a consequence.

Plus, since evolution is an OBSERVED FACT, and I have posted scientific papers that document the observations of evolution taking place in real world living organisms including speciation events observed in the laboratory, all of which refute your masturbatory bullshit above about evolution, none of which you have bothered to read or attempt to understand because you are so convinced that your doctrinal blinkers are the last word in "truth", and all of which are accepted as valid evidence by real scientists (you know, the people who spend decades of their life studying and researching the subject intensively, as opposed to posting pompous, bombastic fuckwittery on the Internet about it based upon rampant and wilful ignorance), your above statement is beneath deserving of a point of view.

So, once again, here is the challenge that Joe Morreale will chicken out of again when I post it:

PROVIDE A CITATION TO THE EXACT SURA IN THE KORAN THAT CONTAINS A DETAILED DESCRIPTION OF THE NAVIER-STOKES EQUATIONS.

After all Joe, YOU are the one who is asserting that your kiddy fiddler's book of ramblings is a valid scientific text, so I'm giving you the chance to put your money where your mouth is. Capable of doing that? Or are we going to see yet more evasion and apologetic bleating, accompanied by repeat spamming of the pages with the URL of your worthless website, composed of the output of circle-jerk practitioners of apologetics for a masturbation fantasy of a doctrine?

Thu, 10 Jul 2008 13:37:00 UTC | #197448

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 868 by Calilasseia

To Kiki,

...

Why do you not become a Muslim and i will ask you to marry me and take care of you?


Showing your true colours now Joe?

Anyone else here regard this blatant hitting on a female poster as creepy and offensive?

Thu, 10 Jul 2008 06:29:00 UTC | #197202

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 865 by Calilasseia

lickin sardines is a way of saying that you are bitter and devastated.


In your dreams.

If your book of myths is so scientifically wonderful, how come most islamic nations are backward shit holes, several of which have only been rescued from descending into the primeval slime because they were lucky enough to have lots of oil underneath them?

Most islamic countries can't even make a working ballpoint pen themselves. They have to buy the expertise in from the West with oil money. That's going to come to an end the moment we develop oil-independent energy technologies, and then we'll see how backward these nations really are when the funds that prop them up come to an end.

The Qu'ran mentions dozens of Scientific facts


Funny how you can't point to a specific one that I asked for.

which are SUFFICIENT to prove that it is from God


Still hypnotising yourself with the music of the spheres of your own verbal diarrhoea whilst staring glassy eyed at the doctrinal hologram inside your head? Only thus far, you haven't provided anything that even remotely meets the definition of evidence. Where are your valid scientific paper citations? Where are your expositions of the content thereof? You have none. All you have is blind assertion and apologetic bluster.

like the admissions of non-muslims scientists on SCIENCEISLAM.COM testify


Your worthless website consists of apologists force-fitting valid science to presupposition. It is about as scientifically valid as Grimm's Fairy Tales.

Your verbal acrobatics


Pot, kettle, black.

The only one engaging in apologetic evasion here is you.

When are you going to be man enough to meet the SPECIFIC CHALLENGE that I put to you? Or are you an intellectual chicken?

are powerless to do anything about it.


The REAL SCIENTISTS of the world aren't listening to blowhards like you. They're getting on with the business of understanding reality without the need for your worthless doctrine or your non-existent invisible magic man.

Your opinion and that of anyone else on this site is worthless by comparison.


Spare me your impotent display of puerile indignation. The critical thinkers here bothered to become educated, which is more than you manifestly bothered to do. What part of "uncritical acceptance of the unsupported assertions of a doctrine" constitutes an intellectually valid stance in any logically consistent universe?

COME TO TERMS WITH THE FACT THAT IT IS ALL OVER and as we say in sicilian-style: non fare il lupo!


Yes, it's all over for your doctrinal masturbation fantasies ...

which is a term that is used against a person who knows but ignores or pretends not to but it is futile as the person knows it


You're really good at projection aren't you?

Thu, 10 Jul 2008 06:26:00 UTC | #197196

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 823 by Calilasseia

To Calilasseia

How you doin with those sardines your lickin?!


What is this bilge supposed to mean?

Do you have anything even remotely resembling a constructive coment here instead of your usual blind assertion and apologetic bluster?

IT SO EASY TO PROVE MY POINT:

ATLAS OF CREATION AND....

SCIENCEISLAM.COM


Repeatedly parroting these two disreputable and wholly discredited sources as though they are scientifically valid isn't good enough. Harun Yahya's book is the work of a CHARLATAN. Your "scienceislam" apologists are doing nothing other than force-fitting valid science to the presuppositions of a doctrine.

So are you going to take that challenge I gave above Joe? Are you man enough to attempt it, or are you too much of an intellectual chicken to face it?

Here's the challenge again:

PROVIDE A CITATION TO THE EXACT SURA IN WHICH THE KORAN DESCRIBES THE NAVIER-STOKES EQUATIONS IN DETAIL.

After all, YOU are the one asserting that this book is a valid science text. Let's see if it is courtesy of this challenge, shall we? Or are you going to chicken out of even touching this one?

Thu, 10 Jul 2008 05:24:00 UTC | #197141

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 812 by Calilasseia

LET US START WITH A BANG!


Given that we all arise from sexual intercourse, this hardly needs stating explicitly ...

21:30 "DO NOT THE UNBELIEVERS SEET THAT THE HEAVENS AND THE EARTH WERE JOINE TOGETHER, BEFORE WE CLOVED THEM ASUNDER? WE MADE EVERY LIVING THING OUT OF WATER. WILL THEY TEN NOT BELIEVE?"


Ah, mindless proselytising in CAPS LOCK mode.

Joe, posting your worthless drivel in CAPS LOCK mode doesn't stop it from being drivel.

Plus, your turgid and worthless holy book talks about Adam being formed, fully adult and fully conscious, with fully adult cognition, from a ball of dirt. So your worthless old tome cannot even maintain consistency with respect to the basics.

LET ME ASK YOU, HOW CAN YOU STILL NOT BELIEVE?!


Easy. We take off the doctrinal blinkers and look at the real world as it actually is instead of through your distorting ideological prisms.

As always when a person is truly on a mission to seek truth SINCERETY and OBJECTIVITY are key, otherwise he is in reality following/worshipping
HIS OWN WHIMS AND DESIRES even though he knows inside that it is in vain.


Nice revelation of your own motives and the motives of every other adherent of doctrine there. In other words, a combination of the need to conform allied to rampant narcissism.

This becomes clear when solid evidence is presented and it is still not accepted.


You've been doing plenty of summary dismissal of actual evidence thus far. Have you even bothered to read the citations for those scientific papers I presented, let alone the actual papers themseslves?

Again go and view the stunning example of admissions of non-muslim scientists on SCIENCEISLAM.COM which leave no room for a A SUCCESSFULL REFUTATION.


Bullshit. Those scientific papers I cited blow your collection of doctrinal apologists out of the water with nuclear depth charges. Because that is what those individuals are engaging in - doctrinal apologetics. Which is worthless in genuine intellectual circles, because apologetics consists of nothing more than the erection of convoluted semantic justifications for presuppositions. Science, on the other hand, is in the business of testing presuppositions to destruction.

All that your worthless apologists are doing is walking up to the scientific bullet holes and drawing apologetic bullseyes around them. They're engaging in nothing more than retroactive force-fitting of science to the presuppositions of a doctrine. A well-known logical fallacy, which, speaking of cowboys, is known as the Texas Sharpshooter Fallacy.

THE QU'RAN PROVES CONCLUSIVELY THAT IT IS INDEED FROM GOD.


Circular argument. Therefore worthless.

WHEN MANY PEOPLE FROM ALL OVER THE WORLD INCLUDING SCIENTISTS ARE INCREASINGLY COMING TO ISLAM, OF WHAT WORTH ARE YOUR LIES AND DISTORTIONS?


I love the way that propagandists for reality-denial masturbation-fantasy doctrines invert reality in this fashion, and claim that looking at the real world as it is and drawing appropriate conclusions therefrom constitutes "lies and distortions", whilst uncritical acceptance of the unsupported assertions of their doctrine is held up by them as The Truth™. The blinkers they wear are such that they cannot see the absurdity of this.

Sincere people who learned Arabic before commiting and confirming the inevitable fact that the Qu'ran is from God.


Ask yourself, Joe, why are all the other religions false? Then when you have answered that, you'll know why we think yours is false, because the same principles apply. To state otherwise consists of merely asserting that your doctrine possesses a privileged status over and above all the others, which of course is a well-known part of the aetiology of the doctrine centred mindset.

YOUR TRYING TO CAST DOUBT BY YOUR LIES AND ACROBATIC DISTORTING OF THE ARABIC.


I haven't mentioned any Arabic at all. I have, on the other hand, presented numerous scientific papers which you have ignored and summarily dismissed because those papers fail to genuflect before your masturbation fantasy of a doctrine.

WHAT YOU PRESENT HAS BEEN REFUTED LIVE ON MANY LECTURES AND DEBATES ALL OVER THE WORLD BY DR ZAKIR NAIK.


Who?

Should I know this individual at all? What is his claim to fame, other than as an apologist for doctrine? Because if that is his only claim to fame, I suspect that this is all I need to know about him, because anything he says as a consequence of being an apologist for doctrine will be intellectually superfical, shallow, worthless and vacuous.

At the end of his lectures the same stuff that you allege as mistakes are swatted in his long question and answer sessions.


If by this you mean that he erects apologetic word salad in order to sound big and clever, then I have to inform you that genuine refutation of canards takes rather more in the way of learning than this. As you are discovering here, if only you had sufficient functioning brain cells to remove your doctrinal blinkers.

Why do you not go to one of his lectures/debates when he is nearby and present yourself with your distortions and see how you would be exposed I as a fool and liar!


I've a better idea. How about your supposedly "world famous" apologist come here if he's hard enough? We need some new chew toys.

IF YOU HAVE SEEN THIS GUY IN ACTION YOU KNOW HE WOULD ABSOLUTELY HUMILIATE YOU


I suspect the only humiliation I would suffer at his hands would be due to my pissing myself laughing at his inadequacies.

As for this:

The Atlas does have a few mistakes (not many like you say) which in all probability were sincere ones.


This is demonstrable nonsense. Harun Yahya ripped off the work of someone with far less wealth than him in the form of Graham Owen, whose fishing lure artwork was stolen for Harun Yahya's worthless and absurd book of pretentious masturbatory garbage, and in doing so, demonstrated to the world his own rmpant scientific ignorance and incompetence. What part of "only an idiot would mistake a fishing lure with a bloody big metal hook sticking out of its arse end for a real Caddis Fly" are you too stupid to understand?

Nevertheless the rest of the book is solid


Only with respect to its mass. Its content, on the other hand, is droolingly encephalitic nonsense that the average 12 year old in the UK would laugh at for its rampant stupidity.

as can be testified by the fact that the secular establishment are running scared of it.


I love it when propagandists for masturbation-fantasy doctrines don't bother looking beyond the televisions inside their heads.

What part of "we're parading its absurdities worldwide and laughing at them" equates to "running scared" in any logically consistent universe?

Which, in case you hadn't worked this out, we're doing in order to counter the insidious, pernicious and utterly poisonous view that Harun Yahya, you and other doctrinal fantasists are peddling, namely that when reality and doctrine differ, reality is wrong and doctrine is right.

It is obvious that a few fishing lures are not enough to discredit it!


This utterly palsied nonsense can only be written by someone whose mind is so addled by doctrinal conformity at all costs that the denial of reality has transcended the pathological.

What part of "only an IDIOT and a CHARLATAN would mistake a FISHING LURE for a LIVING INSECT" are you too stupid to understand again?

There, I can use CAPS LOCK too. :)

When will people realise that evolution is a deception kept "alive" by propaganda and that anything that is pointed to as so-called evidence never goes beyond the speculation and hypothesies stage?


Bullshit.

Have you studied those scientific papers I have cited in previous posts? No? Then you don't know what you are talking about. The only "propaganda" being peddled here is that being peddled by doctrinal masturbation fantasists like you.

What part of direct experimental test of evolutionary concepts to determine their validity are you too stupid to understand?

Evolution has been refuted from the Molecuar to the Paleontology with many admissions of evolutionists themselves.


Bullshit.

All that has happened is that the words of scientists have been DISHONESTLY QUOTE MINED by mendacious and duplicitous propagandists for doctrine such as you.

IT IS IMPOSSIBLE TO SINCERELY BELIEVE IN IT ANY LONGER - IT IS ALL OVER.


As succinct a description of your creationist masturbation fantasies as one could wish for.

YES I HAVE READ THE ENTIRE BOOK


You have yet to establish that your literacy level extends beyond crayon.

AS I PROUDLY POSSESS ONE AND A FEW FISHING LURES DOES IS INSIGNIFICANT AS COMPARED TO THE REST OF THE EXAMPLES


Only a complete scientific ignoramus could post such gibberish.

What part of "any book purporting to be a scientific text, that mistakes fishing lures for living insects, is worth less than toilet paper" are you too stupid to understand here.

(HUNDREDS) OF FOSSILS WHICH CLEARLY SHOW PHYSICAL EVIDENCE THAT EVOLUTION NEVER TOOK PLACE.


Only in the television inside your head. Keep watching that flickering screen and deluding yourself with that pretty doctrinal hologram of yours.

Once again, did you even bother to read the citations I provided to the scientific papers I presented, let alone their contents?

What a waste of oxygen you are.

THE FACT THAT THE BOOK CONTAINS MANY ADMISSIONS OF ITS INVALIDITIES AND THE FACT THE MASSES ARE NOT TOLD THIS, AT LEAST NOT ON THE MAINSTREAM TELLS WHAT IS GOING ON.


What is this syntactically atrocious word salad supposed to mean again?

SERIOUSLY WAKE UP AND SMELL THE COFFEE.


REAL SCIENTISTS did just that 150 years ago when they flushed your creationist masturbation fantasies down the toilet.

I do not believe the Bible in its entirety is the Word of God as it is well-known and established that it contains many errors including scientific ones.


And cue the apologetic assertion in the next sentence ...

BUT the same cannot be labeled at The Qu'ran which is infallible


Bullshit. Mere blind assertion on your part. Which, apart from apologetic bluster, is virtually all you have presented.

as witnessed by many people who are more and more learning of its scientic compatability with ESTABLISHED modern scientific findings


Texas Sharpshooter Fallacy. Mere retroactive force-fitting of scientific reality to conform to doctrinal presuppositions. All that is happening is that propagandists for your worthless doctrine are drawing apologetic bullseyes around the scientific bullet holes.

Take a look at what non-Muslim scientists have admitted on SCIENCEISLAM.COM and then tell me what you think


I've just described what they're doing above. How many times does this need to be repeated before it sinks into the concrete inside your skull?

These people and many others learned the Arabic before confirming that it is indeed of Divine Origin.


Bullshit. They merely accepted uncritically the unsupported assertions of a doctrine.

Surely their word counts more over the liars and cowboys that engage in dishonesty on this site?


Nice admission of your own status here in that sentence above. Because your refusal even to acknowlege the existence of those scientific papers I cited earlier is DISHONESTY ON YOUR PART WRIT LARGE.

The reason why you cannot post or blog on Muslim sites is because there are sadly many cowboys who engage in insults on Prophet and foul language.


Translation: those sites are afraid of having their nonsense refuted wholesale. Excuses, excuses.

We let you come here and post your drivel. We're not afraid to let you vomit forth your droolingly encephalitic nonsense, because we can pound it into its constituent quarks without drawing breath. Why are your wonderful muslim sites afraid to let us visit them? RUNNING SCARED are they?

You are not deluded into thinking that we are scared are you?!


The EVIDENCE speaks for itself. We let you come here and vomit your nonsense because we're not afraid of you and your duplicitous fellow propagandists for masturbation-fantasy doctrine in the least. Your doctrinal fantasy web sites, on the other hand, are shit scared that we will eviscerate their pretensions, their presuppositions and their scientific ignorance.

Going to read any of those scientific papers I cited are you? Assuming of course that you can acquire a literacy level beyond the crayon stage?

People like Adnan Oktar are propagating the truth lies and charlatanism for FREE on the internet and go to many public fossil exhibitions.


There, fixed it for you.

Dr Zakir Naik has done over 1000 public lectures all over the world with long questions and answer sessions where he has always comprehensively dealt with everything that has come his way.


Tell your worthless apologist for doctrine to come here if he thinks he's hard enough.

Those who are actually running scared are the secularists as can be seen by the reaction to the Atlas.


Keep tugging your pudding whilst staring glassy eyed at that pretty doctrinal hologram in the television inside your head. You're talking horseshit. What part of "parading the absurdities of the work of your useless charlatan and laughing at them" equates to "running scared" in any logically consistent universe?

it is GAME OVER


For your masturbation-fantasy world view, it is.

The reasons for doing so? Obvious. It is the manifest truth.


Horseshit. Your book of diseased ramblings from your kiddy fiddler prophet is about as "truthful" as kent Hovind's tax returns.

It is the only scripture as testified by an increasing number of people to be scientifically compatable with modern established science.


Total bullshit. All that is happening is that apologists for doctrine are force-fitting valid science to conform to doctrinal presuppositions.

Tell you what, if your book of kiddy fiddler ramblings is such a wonderful scientific text, point to the part where it discusses the Navier-Stokes Equations. I want you to point to the precise sura that describes them in detail.

That's a challenge you'll never meet. Quite a few people here will probably put serious money on that one.

All that a person needs is sincerety and objectivity when in search for the truth


And what part of "uncritical acceptance of the unsupported assertions of doctrine" equates to "sincerity and objectivity in pursuit of the truth" in any logically consistent universe?

It is clear that such an insincere disposition from a person in that case is not worthy or deserving of GUIDANCE from God who will just leave that person wandering blindly in his ignorance.


I love the way that "ignorance" is defined by this masturbation fantasist as "failure to accept uncritically the unsupported assertions of my doctrine". A definition no dictionary on the planet would accept.

There are many pschological barriers that can be obstacles on the path to the truth such as:

Family tradition/culture
Social pressure
Pride/arrogance and rebellion
Difficulty in abandoning a certain life-style etc


You forgot to mention "unwillingness to discard doctrinal blinkers".

Now if a person does not make the effort in realising that surely God is more important than anything, that person even if shown the truth will not see it or simply ignore.


Provide substantive evidence that your invisible magic man actually exists, in accordance with proper evidential standards as opposed to the standards of your worthless apologetics, and we'll listen. Until then, if all you have to offer is blind assertion and apologetic bluster, we'll treat your wibblings with the scorn and derision they deserve.

So, here's the challenge that I predict Joe Morreale will NEVER meet. Namely:

POINT TO THE EXACT SURA IN THE KORAN THAT DESCRIBES IN DETAIL THE NAVIER-STOKES EQUATIONS.

After all, if the Koran is a valid science text, it should be easy to do this, shouldn't it?

Thu, 10 Jul 2008 04:55:00 UTC | #197115

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 699 by Calilasseia

Vinelectric, the following page should prove highly enlightening in this respect:

The Authoritarians by Bob Altmeyer

Wed, 09 Jul 2008 15:51:00 UTC | #196824

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 677 by Calilasseia

Time to deal with some of Joe Morreale's droolingly encephalitic nonsense and inability to use his CAPS LOCK key properly ...

WHY DO THEY NOT ALLOW THE POSSIBILITY OF A SUPERNATURAL EXPLANATION TO THE PHENOMENA OF THE UNIVERSE?


Because supernatural entities are by definition not subject to reliable and repeatable empricial test. Whereas natural phenomena are. What part of this elementary concept are you incapable of understanding?

SIR FRED HOYLE:
"Indeed, such a theory (that life was assembled by an intelligence) is so OBVIOUS that one wonders why it is not widely accepted as being self-evident. The REASONS ARE PSYCHOLOGICAL RATHER THAN SCIENTIFIC."


Fred Hoyle wasn't a biologist. Plus, his remarks demonstrate an ignorance of the subject, such as his use of bad probability calculations based upon absurd notions (biologists don't claim that living things arose "by chance", but as a consequence of well defined and testable processes) and stupid analogies (Dawkins himself dealt with the "747" nonsense in TGD, which is just a repackaged version of Paley's "watchmaker" argument that was demolished by Darwin 150 years ago). He also made mistakes in his own field of astrophysics. Of course, there was much that he was right about, including stellar nucleosynthesis, so we can forgive him some of his other errors, which he made whilst genuinely striving to understand the operation of the universe, as opposed to the parroting of canards by propagandists for doctrine that pollute the comments section of this page. Unfortunately, some of Hoyle's ideas were blind alleys, and he made the mistake of being too wedded to those blind alleys to change his views. This does not in the least diminish his contributions in those areas where he was right of course.

Here's a tip for you: what is the difference between a 747 and a living organism? answer this correctly and you'll understand why the "747" argument is total tosh.


RICHARD C LEWONTIN of Harvard Uni
"It is not that the methods and institutions of science somehow compel us to accept a MATERIAL EXPLANATION of the phenomenal world, but, on the contrary, that WE ARE FORCED BY OUR PRIORI ADHERENCE TO MATERIAL CAUSES to create an apparatus of investigation and set of concepts that produce material explanations, n o matter how counter-intuitive, no matter how mystifying to the uninitiated. MOREOVER, THAT MATERIALISM IS ABSOLUTE, SO WE CANNOT ALLOW A DIVINE FOOT IN THE DOOR."


Which he said because "allowing a divine foot in the door" is a guaranteed way of leading to bad science. Look at organisations such as AiG, ICR and the Discovery Institute, which all provide evidence for this phenomenon. None of them practise real science, instead they practise religious apologetics dressed up in scientific sounding language.

Science depends upon being able to perform repeatable and reliable empirical tests of its ideas. Because ONLY by performing such empirical tests can we determine whether or not the ideas being tested are in accord with observational reality. Supernatural entites are untestable. Therefore they cannot be admitted because they are scientifically useless.

Again, what part of this elementary concept are you incapable of understanding?

The above exposes and makes clear the false and deliberately imposed deception that Religion and Science cannot co-exist.


They can co-exist so long as religion does not arrogantly assume that it has the right to tell scientists what to think and how to conduct their research. The moment it does that, it becomes a pestilence. Again, what part of this elementary concept are you incapable of understanding?

More and more people are becoming aware of what is going on and abandon belief in this sinister fairy tale.
It is clear that those who stubbornly cling to it are only doing so out of vain wishful-thinking.


Your doctrine IS a fairy tale. Unfortunately for fetishistic adherents of masturbation-fantasy, reality-denial world views such as the one you are propagandising for, evolution is massively supported by evidence from observational reality. I don't suppose you bothered to check out any of the large number of scientific papers I have cited in previous posts that contain some of that evidence, have you? But then the aetiology of doctrine-addled creationists is all too familiar to the critical thinkers here: ignore any evidence that contradicts their masturbation fantasies and pretend that it doesn't exist.

It is an utter mockery of democracy the fact that both Creationism and darwinism are not taught alongside eachother as two possible explanations for the universe.


You appear to be wholly ignorant of a basic notion. Namely that scientific theories are NOT a "popularity contest" or the subject of public opinion. The ONLY criterion that matters is whether or not those theories are in accord with observational reality. Theories that are not thus in accord, like phlogiston, are discarded. Creationism is discarded for the same reason - namely it is flatly contradicted by observational reality. Again, what part of this elementary concept are you incapable of understanding?

THE SECULAR ESTABLISHMENT KNOW AND RIGHTLY FEAR THE RESULTS - THEY HAVE SEEN THE IMPACT THE ATLAS HAS HAD ON SINCERE AND OBJECTIVE STUDENTS IN US AND EUROPE AND HENCE THE ATTEMPT TO BAN IT!


Total bullshit.

We don't need to ban this stupid book, we can let its absurdities speak for themselves.

Why shoud we bother to ban this book when its own manifest stupidity is the best weapon we could possibly have? A book that contains pictures of fishing lures and presents them as real living creatures? A better advertisement for the intellectual vacuity and bankruptcy of creationist masturbation fantasies we could not wish for!

It is a pointer to your own blinkered stupidity that you not only do not realise this, but also do not realise that any reasonably educated five year old can see that picture of the "Caddis Fly" with the bloody great metal hook sticking out of its arse end and realise that this book is a pathetic joke. Care to point me to any real, living insects that possess large metal hooks sticking out of their arse ends? Only in my years spent studying entomology, I never encountered any. I wonder why that is?

THE FEW SINCERE MISTAKES FROM THE ATLAS OF CREATION DO NOT IN ANY WAY CANCEL OUT THE REST OF THE WORK WHICH UTTERLY EXPOSES, REFUTES AND RUINS THE FAIRY TALE CALLED EVOLUTION.


This is just apologetic wankery to distract from the fact that Harun Yahya is a charlatan whose ignorance of basic biology would be an embarrassment to secondary school children here in the UK. The only fairy tales being spun around here are the ones being spun by fetishistic adherents of masturbation-fantasy doctrines such as creationism. The idea that this ridiculous book, filled with basic errors that a twelve year old in a UK school would wet himself laughing at, somehoe "refutes" the untold millions of man-hours of patient observation, experiment and analysis that provide the massive evidential support for evolution is possibly the most pathetic joke you have told thus far. But then what else can one expect from an intellectual clown but pathetic jokes masquerading as serious comment, a category that so many of your worthless eructations fall into so neatly?

or find them spread about on youtube where as ever the Truth is mixed and surrounded by cowboys.


Yes we've seen plenty of creationist cowboys on YouTube. All of them classic examples of the mental retardation that results from inbreeding.

I HAVE PROVEN SCIENTIFICALLY THE FOLLOWING:

That evolution is a deception only kept "alive" by propaganda


The only thing you have proven is that you're a doctrine-addled masturbation fantasist. Don't suppose you bothered to read any of those scientific papers I cited in earlier posts that make a mockery of your arrogant pretensions to know better about biology than the world's biologists?

Modern Science has clearly shown that God exists.


Total crap. Where does it say this in any of the critically robust peer reviewed scientific literature again? Do you have a CITATION for this? Put up or shut up, big mouth.

The Qu'ran is indeed the word of God and also shows that He exists.


Your book consists of nothing but the diseased and psychotic ramblings of a kiddy fiddler. Your book is worthless as a scientific document, and worth even less as a guide to morality. In short, your holy book is something I wouldn't allow near any children of mine lest they end up needing psychiatric treatment from the shock of reading its barbaric contents.

IN ANYCASE TRUTH STANDS FIRM AGAINST FALSEHOOD AS MANY PEOPLE ARE BEGINNING TO SEE.


Which is why science REJECTED CREATIONIST MASTURBATION FANTASIES 150 YEARS AGO.

See, I can use CAPS LOCK as well.

ADNAN OKTAR HAS RUINED THE FALSE HOPES OF THOSE WHO WERE COMFORTABLE WITH THEIR WORLD VIEW.


The only thing Oktar has ruined is the integrity of his rectum as a result of being sentenced to prison. What part of "Oktar is a moron who published a book presenting fishing lures as real living insects" are you too stupid to understand here?

Meanwhile ....

Oh look, ertu is back with his nonsense.

Let's take a look at this pathetic pile of steaming intellectual excrement shall we?

The Fossil Record:
No Sign of Intermediate Forms


Total bullshit.

I can list no less than fifteen species of transitional theropod that have been discovered by scientists with respect to the transition between reptiles and birds alone. All of them extensively documented in the scientific literature. Here's the list (in no particular order):

Sinosauropteryx
Protarchaeopteryx
Caudipteryx
Shuvuuia
Sinornithosaurus
Beipiaosaurus
Microraptor
Epidendrosaurus
Cryptovolans
Scansoriopteryx
Yixianosaurus
Dilong
Pedopenna
Jinfengopteryx
Sinocalliopteryx


Then there's the list of tetrapods in the series from Rhipidistian fishes to Temnospondyl amphibians. Here's a representative list (again in no particular order):

Eusthenopteron
Metaxygnathus
Obruchevichthys
Elginerpeton
Sinostega
Hynerpeton
Tulerpeton
Densignathus
Jacubsonia
Panderichthys
Tiktaalik
Ventastega (newly discovered in 2008)
Acanthostega
Ichthyostega


I happen to have been in receipt of the original scientific paper by Per Ahlberg et al on the subject of Ventastega, which is a relatively complete fossil and which has been described in full in the following paper:

Ventastega curonica And The Origin Of Tetrapod Morphology by Per E. Ahlberg, Jennifer A. Clack, Ervïns Lukševičs, Henning Blom, & Ivars Zupiņs, Nature, 453:1199-1204 (26th June 2008)

I'll quote the abstract here:

The gap in our understanding of the evolutionary transition from fish to tetrapod is beginning to close thanks to the discovery of new intermediate forms such as Tiktaalik roseae. Here we narrow it further by presenting the skull, exceptionally preserved braincase, shoulder girdle and partial pelvis of Ventastega curonica from the Late Devonian of Latvia, a transitional intermediate form between the 'elpistostegids' Panderichthys and Tiktaalik and the Devonian tetrapods (limbed vertebrates) Acanthostega and Ichthyostega. Ventastega is the most primitive Devonian tetrapod represented by extensive remains, and casts light on a part of the phylogeny otherwise only represented by fragmentary taxa: it illuminates the origin of principal tetrapod structures and the extent of morphological diversity among the transitional forms.


So, there's one scientific paper (published less than two weeks ago no less) that blows this canard out of the water.

I also refer the critical thinkers (because the creationist propagandists for masturbation-fantasy doctrines will doubtless ignore any evidence that fails to genuflect before their fantasies) to the following images:

Phylogeny of Tiktaalik roseae and its relation to other organisms in the series

Comparative anatomy of the forelimbs of Tiktaalik and selected organisms in the tetrapod phylogeny

Moreover, here is another paper from Per Ahlberg and Jennifer Clack, who are widely regarded being among the foremost experts in the field of tetrapod palaeontology and phylogeny:

Original PDF document of Ahlberg & Clack paper from which the original images above were taken

This paper is:

A Firm Step From Water To Land by Per E. Ahlberg and Jennifer A. Clack, Nature, 440: 747-749 (6th April 2006)

I quote from this paper:

A project designed to discover fossils that illuminate the transition between fishes and land vertebrates has delivered the goods. At a stroke, our picture of that transition is greatly improved.

The concept of 'missing links' has a powerful grasp on the imagination: the rare transitional fossils that apparently capture the origins of major groups of organisms are uniquely evocative. But the concept has become freighted with unfounded notions of evolutionary 'progress' and with a mistaken emphasis on the single intermediate fossil as the key to understanding evolutionary transitions. Much of the importance of transitional fossils actually lies in how they resemble and differ from their nearest neighbours in the phylogenetic tree, and in the picture of change that emerges from this pattern.

We raise these points because on pages 757 and 764 of this issue1,2 are reports of just such an intermediate: Tiktaalik roseae, a link between fishes and land vertebrates that might in time become as much of an evolutionary icon as the proto-bird Archaeopteryx. Several specimens have been found in Late Devonian river sediments on Ellesmere Island in Nunavut, Arctic Canada. They show a flattened, superficially crocodile-like animal, with a skull some 20 centimetres in length. The body is covered in rhombic bony scales, and the pectoral fins are almost-but-not-quite forelimbs; these contain robust internal skeletons, but are fringed with fin rays rather than digits. Tiktaalik goes a long way â€" but not quite the whole way â€" towards filling a major gap in the picture of the vertebrate transition from water to land.

It has long been clear that limbed vertebrates (tetrapods) evolved from osteolepiform lobefinned fishes3, but until recently the morphological gap between the two groups remained frustratingly wide. The gap was bounded at the top by primitive Devonian tetrapods such as Ichthyostega and Acanthostega from Greenland, and at the bottom by Panderichthys, a
tetrapod-like predatory fish from the latest Middle Devonian of Latvia (Fig. 1). Ichthyostega and Acanthostega5 retain true fish tails with fin rays but are nevertheless unambiguous tetrapods with limbs that bear digits6. Panderichthys7 is vaguely crocodile-shaped and, unlike the rather conventional osteolepiform fishes farther down the tree, looks like a fishâ€"tetrapod transitional form. The shape of the pectoral fin skeleton and shoulder girdle are intermediate between those of osteolepiforms and tetrapods, suggesting that Panderichthys was beginning to 'walk', but perhaps in shallow water rather than on land8.

Panderichthys lived about 385 million years ago at the end of the Middle Devonian; Ichthyostega and Acanthostega lived about 365 million years ago during the Late Devonian. However, the earliest fragmentary tetrapods from Scotland9,10 and Latvia9 date back to perhaps 376 million years ago, so the morphological gap between fish and tetrapod corresponds to a time gap of under 10 million years.

Into this gap drops Tiktaalik. The fossils are earliest Late Devonian in age, making them at most 2 million or 3 million years younger than Panderichthys. With its crocodile-shaped skull, and paired fins with fin rays but strong internal limb skeletons, Tiktaalik also resembles Panderichthys quite closely. The closest match, however, is not to Panderichthys but to another animal, Elpistostege, from the early Late Devonian of Canada. Elpistostege is known only from two partial skulls and a length of backbone, but it has long been recognized as a fishâ€" tetrapod intermediate11,12, probably closer to tetrapods than is Panderichthys. This impression is now confirmed: the authors1,2 demonstrate convincingly that Elpistostege and Tiktaalik fall between Panderichthys and the earliest tetrapods on the phylogenetic tree.


So, that's the "no transitional forms" canard busted by two recent scientific papers at least, along with the evidence from the fossil record. Oh, and Tiktaalik was predicted to exist before it was found: not only was it predicted to possess a specific morphology, but was also predicted to be most likely to be found in a particular geographical location and in a particular stratum. When the scientists went looking for it, they found it exactly in the predicted location and it manifested the predicted morphology. In other words, transitional forms are not only real, but in the case of Tiktaalik, was predicted to exist before it was found, and when found, matched the scientists' predictions.

Now, returning to ertu's masturbatory nonsense:

The clearest evidence that the scenario suggested by the theory of evolution did not take place is the fossil record.
According to this theory, every living species has sprung from a predecessor. A previously existing species turned into something else over time and all species have come into being in this way. In other words, this transformation proceeds gradually over millions of years.
Had this been the case, numerous intermediary species should have existed and lived within this long transformation period.


Those scientific papers above say that they did. Now who are the critical thinkers going to believe here? Two of the world's foremost scientific experts on tetrapod palaeontology and phylogeny, and their publicly presented evidence in the critically robust peer reviewed scientific literature, or some joker who thinks that he knows more than all the world's scientists just because he has an old holy book full of diseased rmblings inserted into his rectum?

For instance, some half-fish/half-reptiles should have lived in the past which had acquired some reptilian traits in addition to the fish traits they already had.


Wrong, you mean transitional forms between fishes and amphibians. And I've just presented two scientific papers containing those very animals. Game over.

Or there should have existed some reptile-birds, which acquired some bird traits in addition to the reptilian traits they already had.


Have you never seen an Archaeopteryx fossil? It has a beak like a bird, but teeth like a reptile. It has feathers like a bird, but a bony tail like a reptile. It has a wishbone like a bird, but no keeled breastbone, and moreover, its reptilian features correspond closely to those of a family of theropod dinosaurs known as the Dromaeosauridae.

So, before you spout nonsense about this not being a "transitional form", I suggest you learn some basic comparative anatomy.

Since these would be in a transitional phase, they should be disabled, defective, crippled living beings


Bullshit. Only a complete scientific ignoramus could make such a statement.

Those fifteen species of transitional theropod I listed above (which includes Archaeopteryx) weren't "disabled, defective, crippled living beings", they were fully functional living organisms that happened to possess the requisite transitional features. But then, like all other fetishists for masturbation-fantasy doctrines, you won't let the actual scientific facts get in the way of your proselytising for your worthless doctrine, will you?

Evolutionists refer to these imaginary creatures


Er, since scientists have found the requsite fossils and documented them in the scientific literature, they are all too real. The only thing "imaginary" here is your fantasises about the way the world operates.

which they believe to have lived in the past


We have the fossils. Science wins, you lose.

as "transitional forms."


Which even an elementary student of comparative anatomy can recognise as such. But then I don't suppose you ever learned any real science did you ertu?

If such animals ever really existed, there should be millions and even billions of them in number and variety.


Oh there were large numbers of them. However, not all of them fossilised. Palaeontologists have to make do with the samples that the real world chooses to give them. However, if these creatures were, as you say, "imaginary", then NONE should have existed. They plainly DID exist, as we have the fossils. Once again, game over.

More importantly, the remains of these strange creatures should be present in the fossil record.


See above. I've just presented two scientific papers containing them. Once again, game over.

In The Origin of Species, Darwin explained:
"If my theory be true, numberless intermediate varieties, linking most closely all of the species of the same group together must assuredly have existed... Consequently, evidence of their former existence could be found only amongst fossil remains."


Oh look, it's DISHONEST QUOTE MINE TIME AGAIN. Why does this not surprise me in the least?

Let's see what Darwin said in FULL, shall we?

Lastly, looking not to any one time, but to all time, if my theory be true, numberless intermediate varieties, linking most closely all the species of the same group together, must assuredly have existed; but the very process of natural selection constantly tends, as has been so often remarked, to exterminate the parent forms and the intermediate links. Consequently evidence of their former existence could be found only amongst fossil remains, which are preserved, as we shall in a future chapter attempt to show, in an extremely imperfect and intermittent record.


Oh look what was missed off the end. Once again, a DISHONEST QUOTE MINE from our resident propagandist for masturbation-fantasy doctrine.

Oh, and ertu, no reputable scientist claims that evolution operates "by chance", so stop spouting that worthless and blatantly false canard once and for all will you, because every time you spout it, you present a spectacle of yourself as being an even bigger moron than previously.

Wed, 09 Jul 2008 14:04:00 UTC | #196783

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 571 by Calilasseia

First of all, allow me to extend a hearty welcome to Kaph. Who provides welcome evidence that individuals capable of distinguishing reality from fantasy are present everywhere, even if local circumstances might make life difficult for them at times. :)

In reply to this:

@Fellows who have put up with BS by ertu et al.

Are you on tranquillizers or what? At least 300-400 comments after first trolling and excluding them, and you're still up and arguing? What kind of patience is that? Totally unbelievable. I take my hat off to you all. No racism, which Turks suffer heavily from on the web, despite repeated provocative attitude. Seriously. I would not have written anything here had it not been for an extraordinary patience on your part and the need I felt to thank Richard.


Well, I can only speak for myself, but my personal policy is that mendacious propaganda for a doctrine, the assorted lies and other instances of discoursive malfeasance that inevitably accompany it, and rampant scientific illiteracy should be confronted head on. The lies of propagandists for reality-denial doctrines should be exposed to the fullest extent whenever possible so that their lies can be seen by even the most causal of observers to be demonstrably and manifestly lies, the rampant stupidity and scientific illiteracy of such doctrines should be brought out into the open and exposed as such, and when patient explanation of the fallacies and errors inherent therein fails to dissuade the ideological warrior for doctrine from continuing along the same path of mindless proselytising, ridicule should inevitably follow, because ridicule is what such individuals plainly deserve. At times, the exercise of this process does take an inordinate amount of patience, but it requires less patience if one possesses a taste for debunking canards.

The simple fact is, that once we encounter an individual such as ertu, with the all too familiar aetiology of the doctrine addled mind, our purpose is not that of trying to educate the propagandist for doctrine, because such an individual is beyond education. Once a doctrine such as creationism takes hold in the mind, it distorts not only thought but perception itself, to the point where the adherent's very sensing of the real world is subject to doctrinal censorship. Such an individual is impervious to reason, to evidence, to any of the usual processes of discourse that you and I understand to be proper conduct with regard to the discussion of the validity of various postulates about the world. The critical thinkers here are not interested in any attempt at educating the hardcore ideological warriors for doctrine, because we know in advance that this is utterly futile. Our labours here can be thought of as a vaccination process - by exposing the fallacies, the errors, the mendacity and duplicity of the ideological warriors for doctrine, by making them manifest, we inoculate lurkers (such as you yourself were before your post above) against intellect-rotting doctrinal mind viruses. Reason, rational discourse, along with a healthy dose of ridicule of absurdities thus deserving of it, constitutes the vaccine that helps to reduce the incidence of infection by ideological pathogens, as you are doubtless aware. There are occasions when our labours take on the mantle of a thoroughly thankless task, but when an individual such as yourself emerges from the shadows to thank us for our efforts, we know that it has all been worthwhile. :)

Wed, 09 Jul 2008 05:01:00 UTC | #196492

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 506 by Calilasseia

Well looks as if Ertu isn't going to address the fact that his ridiculous probability calculations are rendered null and void by my citation of the variation in insulin molecules in real living organisms, so I suppose I'm done here, as he's plainly nothing more than a cut-and paste troll who is manifestly wilfully ignorant and committed wholesale to being ideological cannon fodder for a masturbation fantasy of a doctrine. What a total waste of oxygen.

Tue, 08 Jul 2008 15:14:00 UTC | #196176

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 503 by Calilasseia

Calilasseia who doesnt know anythinf about statistics and matemathics.


Well since I happen to have studied mathematics at university, and moreover can spell it properly, that's another of your assertions that is complete and utter horseshit.

I don't suppose you will ever address any of the outstanding questions will you Ertu? All you will continue doing here is spamming the comments section with your masturbatory nonsense and assorted cut and paste screeds from creationist websites because you're too incompetent to form thoughts of your own.

Tell me Ertu, why should I believe for one moment the ravings of someone who cannot tell a LIVING INSECT from a FISHING LURE? Or for that matter the ravings of someone who, like you, cannot even spell "mathematics", let alone practise it properly?

Tue, 08 Jul 2008 15:07:00 UTC | #196171

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 493 by Calilasseia

Let's address some more Ertu nonsense shall we?

There are billions of different protein molecules in milions of species. Even a single protein to come into being by coincidences is impossible mathetatically and statistically. That diprove the Evolution at the very basic level Now I will prove you this scientifically:


No you won't because you're talking complete bollocks.

first of all, real scientists have never said that these molecules came about "by chance" or "by coincidence" or "at random". They posited well-defined mechanisms for the appearance of these molecules based upon well-known and well-documented mechanisms of reaction in organic chemistry, which you would know if you had bothered to study any real science instead of filling your head with religious bullshit.

Second, all the bad "probability" calculations eected by creationists FAIL because [1] the probability of an event that has already happened is 1, [2] even if one winds the clock back 3.5 billion years, to when these probability calculations would have been appropriate, they are ALL based upon ex recto assertions that are either left unstated (thus making it impossible to check their veracity) or else, if the creationist makes the mistake of stating the assumptions upon which the calculations are based, they are usually manifestly FALSE assumptions (which is why they are usually omitted), and [3] the calculations are usually based upon the Serial Trials Fallacy, which is a well-known creationist fallacy that falls flat on its face the moment one considers how real world systems operate.

So much for the cell, but the theory of evolution fails even to account for the building-blocks of a cell. The formation, under natural conditions, of just one single protein out of the thousands of complex protein molecules making up the cell is impossible.


Complete twaddle. Scientists have documented it taking place in the laboratory. Try reading some of those scientific papers I cited in an earlier post instead of the tripe spread about like so much intellectual excrement by charlatans and fraudsters such as Harun Yahya.

Proteins are giant molecules consisting of smaller units called "amino acids" that are arranged in a particular sequence in certain quantities and structures.


You obviously didn't read my earlier post where I documented the different insulin proteins in different organisms. What is selected for is not a specific sequence, but any sequence that produces a working protein. Of course, if you'd actually READ my earlier post, you would have known better than to erect the One True Sequence™ fallacy, especially as I posted that material on Insulin specifically to pre-empt that fallacy being erected. Congratulations upon demonstrating once again that you don't bother reading anything that dares not to genuflect before your worthless doctrine, and that you are only here to spam the comments section and proselytise for your useless masturbation-fantasy world view.

These units constitute the building blocks of a living protein. The simplest protein is composed of 50 amino acids, but there are some that contain thousands.


Since this is a statement of yours that isn't actually wrong, where did you cut and paste it from? Only the evidence thus far is that when you post any original thoughts of your own (the few of these that exist), you are inevitably wrong.

The crucial point is this. The absence, addition, or replacement of a single amino acid in the structure of a protein causes the protein to become a useless molecular heap.


Wrong. My reference to the insulin molecules of various living organisms dismisses this bullshit at a stroke. Notice that the insulin molecule of the Zebra Fish is not even the same length as the human insulin molecule, but it still works as an insulin molecule, and indeed, in an emergency, if enough of it was collected, it could be used as a stop-gap treatment for a diabetic human patient until human insulin became available. So, your assertion above is total crap as per usual.

Every amino acid has to be in the right place and in the right order.


Wrong. This is the One True Sequence™ fallacy that I specifically covered insulin in my earlier post to debunk. Look at those insulin sequences again. Most of them are not even the same length. You're talking horseshit.

The theory of evolution, which claims that life emerged as a result of chance


This is total bullshit. Evolution does NOT claim that "life emerged as a result of chance", and if you had ever bothered to read a biology textbook you would know this. Evolution states that the moment the first cells came into existence, the existence of dissemination of variation across generations, for which we have evidence (evidence even you can understand in this case - are you identical to your mother?) and the fact that some of that variation will predispose the organisms inheriting that variation to possess differential reproductive fitness with respect to the other organisms of its own species will result in a selection process taking place, that removes those variations reducing reproductive fitness, and increases the proportion of those organisms with increased reproductive fitness in future generations. And, the only reason that the mutations involved in the process of generating the substrate upon which selection acts is described as a "random" process (more properly, a stochastic one) is because we lack the ability to track the behaviour of every last atom in an ecocystem to arbitrary precision. If we had that capability, those mutations would no longer be "random" but predictable, and the result would be that the process would become amenable to quantitiative analysis to an extent that is currently not possible.

is quite helpless in the face of this order, since it is too wondrous to be explained by coincidence.


Except that scientists don't explain it by "coincidence", they explain it by the application of well-documented mechanisms of reaction in organic chemistry. Once again, you FAIL.

(Furthermore the theory cannot even substantiate the claim of the accidental formation of proteins, as will be discussed later.)


Total crap. I listed several scientific papers above on de novo genes appearing in real living organisms and documented to do so in the laboratory. Once again, you FAIL.

The fact that it is quite impossible for the functional structure of proteins to come about by chance can easily be observed even by simple probability calculations that anybody can understand.


Oh here we go, bad probability calculations based upon the One True Sequence™ fallacy (already debunked above) and the Serial Trials Fallacy. yawn, we've seen this crap before, try producing something original here.

For instance, an average-sized protein molecule composed of 288 amino acids, and contains twelve different types of amino acids can be arranged in 10300 different ways. (This is an astronomically huge number, consisting of 1 followed by 300 zeros.)


Except that proteins don't arise by chance. They arise courtesy of well-documented mechanisms of reaction in organic chemistry. Which means that your specious probability calculations are a complete waste of time.

Of all these possible sequences, only one forms the desired protein molecule.


Bullshit. See those insulin molecules I covered above? They're different from each other, in most cases not even the same length, yet they ALL WORK. One True Sequence™ is a fallacy, and you've just committed it.

he rest of them are amino-acid chains that are either totally useless or else potentially harmful to living things.


Those insulin molecules I listed above say you're talking out of your arse.

In other words, the probability of the formation of only one protein molecule is "1 in 10300".


Total crap. See above.

Oh, by the way, can't you even manage superscripts? Didn't you mean "1 in 10300?"

Try becoming educated before coming here to post, because until you become educated, all you will do is prove your ignorance and vomit forth intellectual excrement of the most putrid, stinking order.

The probability of this "1" to occur is practically nil. (In practice, probabilities smaller than 1 over 1050 are thought of as "zero probability").


Wrong. No mathematician would equate a non-zero probability, no matter how small, to zero. Try learning some real science and some real mathematics.

Meanwhile ... with respect to your long cut-and-paste nonsense on left handed proteins, here's some more scientific papers that debunk your creationist tripe:

A possible prebiotic synthesis of purine, adenine, cytosine, and 4(3H)-pyrimidinone from formamide implications for the origin of life by Raffaelle Saladino, Claudia Crestini, Giovanna Costanzo, Rodolfo Negri and Ernesto di Mauro, Bioorganic & Medicinal Chemistry, 9(5): 1249-1253 (May 2001)

A Self-Replicating Ligase Ribozyme by Natasha Paul & Gerald F. Joyce, Proc. Natl. Acad. Sci. USA., 99(20): 12733-12740, 1st October 2002

A Self Replicating System by T. Tjiviuka, P.Ballester and J. Rebek jr., Journal of the American Chemical Society, 112: 1249-1250 (1990)

An Efficient Prebiotic Synthesis Of Cytosine And Uracil by Michael P. Robertson & Stanley L. Miller, Nature,375: 772-774 (29th June 1995)

Carbonyl Sulphide Mediated Prebiotic Formation of Peptides by Luke Leman, Leslie Orgel and M. Reza Ghadiri, Science, Vol 306, pp 283-286, 8 October 2004

Homochiral selection in the montmorillonite-catalyzed and uncatalyzed Prebiotic synthesis of RNA by Prakash C. Joshi, Stefan Pitsch and James P. Ferris, Chemical Communications of the Royal Society of Chemistry, 2497-2498

Nucelotide Synthetase Ribozymes May Have Emerged First In The RNA World by Wentao Ma, Chunwu Yu, Wentao Zhang and Jiming Hu, The RNA Journal, 13: 2012-2019, 18th September 2007

Prebiotic Amino Acids As Asymmetric Catalysts by Sandra Pizzarello and Arthur L. Weber, Science, 303: 1151, 20 February 2004

Prebiotic Synthesis Of Nucleotides by G. Zubay and T. Mui, Origins of Life and Evolution of the Biosphere, 31(1-2): 87-102, February-April 2001:

RNA-Catalysed Nucleotide Synthesis by Peter J. Unrau & David P. Bartel, Nature, 395: 260-263, 17th September 1998

RNA-Catalysed RNA Polymerisation: Accurate And General RNA-Templated Primer Extension by Wendy K. Johnston, Peter J. Unrau, Michael S. Lawrence, Margaret E. Glasner and David P. Bartel, Science 292: 1319-1325 (18 May 2001)

RNA-Directed Amino Acid Homochirality by J. Martyn Bailey, J. Fed. Amer. Socs. Exp. Biol., 12(6): 503-507

These papers cover, among other topics, asymmetric catalysis and homochirality and demonstrate that preferential chiral catalysis of the formation of left handed amino acids is possible, but can be reproduced in the laboratory in conditions similar to those found on a prebiotic Earth

I have given you very powerful evidences and destroyed Darwinism.


Hahahaha .... bullshit.

All you have done is regurgitate cut and paste screeds from discredited creationist websites devoted to bad apologetics for theological pornography. You know NOTHING about REAL SCIENCE. The above scientific papers I have cited destroy your hubristic and ignorant pretensions to know better than the world's actual scientists.

Instead of trying to respond scientifically (yıu can't of course). you cry, scerami curse and insult.


Got an answer for any of those scientific papers I cited above? Which specifically refute your cut and paste nonsense about chirality in amino acids by demonstrating the existence of mechanisms for chiral catalysis that can be reproduced again and again in the laboratory?

That is very poor quality.


Your ignorant nonsense is.

You are not scientists. that is ok.


Actually, some of us are. Some of us have probably forgotten more science than you will ever be capable of learning.

But your situation is worst. I dont feel sorry about you because of your style.


We are completely indifferent to your view of us. What we are concerned with is the venomous nonsense you have chosen to believe in, and which has manifestly addled your mind.

If one protein can not emerge coincidentally, how could millions of species, tte universe. Etc. It is so silly to defend darwinism nonsense. Dont you get it?


Those insulin sequences say you are talking horseshit. You've already shown that you're incapable of recognising why the One True Sequence™ fallacy is a fallacy, even when I provided the source material. Consequently, your hubristic and ignorant assertions that you know better than the world's scientists about such topics are demonstrated to be so much hot air.

Dont u understand what kid of situation you are?


Try repeating that in syntactically correct English. Then perhaps we'll answer.

Tue, 08 Jul 2008 14:48:00 UTC | #196157

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 303 by Calilasseia

Well look like evolins are in trouble with scientific facts


The only one having trouble here, Wooter, is you. Including in your case trouble with basic English.

Or didn't you bother reading my post where I presented numerous scientific papers from evolutionary biologists and other scientists that make a mockery of your worthless fantasies and droolingly encephalitic theological pornography?

Wonder if unityisfact bothered to read that too? Or did he do what mendacious and duplicitous propagandists for reality-denial doctrines usually do, namely dismiss summarily anything that fails to genuflect before doctrine? Classic case of creo-blinkers if ever I saw one.

Plus, is anyone else here developing the suspicion that Ertu, unityisfact and the newcomer Mertd are all sock puppets erected by the same individual? Especially as they contain the same drivel, the same bad English spelling, syntax and grammar (except for the copy-pastes from discredited creationist websites and copy-paste quote mines) and the same wilful ignorance?

Oh, and Adnan Oktar is a charlatan, a fraudster and a moron. He's doing well-deserved jail time precisely because of this, just like another charlatan, fraudster and moron called Kent Hovind.

Tue, 08 Jul 2008 05:36:00 UTC | #195709

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 273 by Calilasseia

I notice that unityisfact totally ignored my large list of scientific papers that refute his masturbation-fantasy creationist doctrine. Why does this not surprise me in the least?

After all, he's only here to troll the comments section proselytising for his worthless doctrine, which was worthless even before the ink was dry on the parchment however long ago his particular version of this droolingly encephalitic fantasy about invisible magic men in the sky was written.

Tue, 08 Jul 2008 04:52:00 UTC | #195672

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 261 by Calilasseia

Oh dear. First Ertu and his witterings inspired by the diseased ramblings of a paedophile, now we have unityisfact trolling the comments section.

Evolution did not happen, eh?

I have a nice list of scientific papers that says you are wrong.

Here they are, broken into convenient sections:

[1] De novo generation of genes:

A New Nylon Oligomer Degradation Gene (nylC) on Plasmid pOAD2 from a Flavobacterium sp. by Seiji Negoro, Shinji Kakudo, Itaru Urabe, and Hirosuke Okada, Journal of Bacteriology, Dec. 1992, p. 7948-7953

Birth of a unique enzyme from an alternative reading frame of the pre-existed, internally repetitious coding sequence by Susumu Ohno, Proc. Natl. Acad. Sci. USA, Vol. 81, pp. 2421-2425, April 1984

De Novo Origination of a New Protein-Coding Gene in Saccharomyces cerevisiae by Jing Cai, Ruoping Zhao, Huifeng Jiang and Wen Wang, Genetics, 179: 487-496 (May 2008)

DNA-DNA Hybridization Analysis of Nylon Oligomer-Degradative Plasmid pOAD2: Identification of the DNA Region Analogous to the Nylon Oligomer Degradation Gene by Seiji Negoro, Shunichi Nakamua and Hirosuke Okada, Journal of Bacteriology, 158(2): 419-424

Evolution of hydra, a Recently Evolved Testis-Expressed Gene with Nine Alternative First Exons in Drosophila melanogaster by Shou-Tao Chen, Hsin-Chien Cheng, Daniel A. Barbash and Hsiao-Pei Yang, PLoS Genetics, 3(7): 1131-1143 (July 2007)

Insertion Sequence IS6100 on Plasmid pOAD2, which degrades Nylon Oligomers by Ko Kato, Kinya Ohtsuki, Hiroyuki Mitsuda, Tetsuya Yomo, Seiji Negoro and Itaru Urabe, Journal of Bacteriology, 176(4): 1197-1200 (Feb 1994)

Nylon Oligomer Degradation Gene, nylC, on Plasmid pOAD2 from a Flavobacterium Strain Encodes Endo-Type 6-Aminohexanoate Oligomer Hydrolase: Purification and Characterization of the nylC Gene Product by Shinji Kakudo, Seiji Negoro, Itaru Urabe and Hirosuke Okada, Applied & Environmental Microbiology, 59(11): 3978-3980 (November 1993)

Novel genes derived from noncoding DNA in Drosophila melanogaster are frequently X-linked and exhibit testis-biased expression by Mia T. Levine, Corbin D. Jones, Andrew D. Kern, Heather A. Lindfors, and David J. Begun, Proceedings of the National Academy of Sciences of the USA, 103(26): 9935-9939 (27th June 2006)

Recently Evolved Genes Identified From Drosophila yakuba and D. erecta Accessory Gland Expressed Sequence Tags by David J. Begun, Heather A. Lindfors, Melissa E. Thompson and Alisha K. Holloway, Genetics, 172: 1675-1681 (March 2006)

[2] Antifreeze Glycoproteins in Antarctic Notothenioid Fishes:

Convergent Evolution of Antifreeze Glycoproteins in Antarctic Notothenioid Fishes and Arctic Cod by Liangbiao Chen, Arthur L. deVries and Chi-Hing C. Cheng, Proceedings of the National Academy of Sciences of the USA, vol 94, pp 3817-3822, 1997

Evolution of an Antifreeze Glycoprotein by Liangbiao Chen and Chi-Hing C. Cheng, Nature, vol 401, pp 443-444, 1999

Evolution of Antifreeze Glycoprotein Gene from a Trypsinogen Gene in Antarctic Notothenioid Fishes by Liangbiao Chen, Arthur L. deVries and Chi-Hing C. Cheng, Proceedings of the National Academy of Sciences of the USA, vol 94, pp 3811-3816, 1997

Functional Antifreeze Glycoprotein Genes in Temperate-Water New Zealand Nototheniid Fishes Infer An Antarctic Evolutionary Origin by Chi-Hing C Cheng, Liangbiao Chen, Thomas J Near and Yumi Jin, Journal of Molecular and Biological Evolution, Vol 20, no 11, pp 1897-1908, 2003

Nonhepatic Origin of Notothenioid Antifreeze Reveals Pancreatic Synthesis As Common Mechanism in Polar Fish Freezing Avoidance by Chi-Hing C Cheng, Paul A. Cziko and Clive W. Evans, Proceedings of the National Academy of Sciences of the USA, vol 103, pp 10491-10496, 2006

[3] Speciation Events : Cichlid Fishes

Adaptive Evolution And Explosive Speciation: The Cichlid Fish Model by Thomas D. Kocher, Nature Reviews: Genetics, 5: 288-298 (April 2004)

Cichlid Species Flocks of the Past and Present by A. Meyer, Heredity vol 95, 419-420, 20 July 2005

Fractious Phylogenies by Thomas D Kocher, Nature, Vol 423, pp 489-490, 29 May 2003

Hybridisation and Contemporary Evolution in an introduced Cichlid Fish from Lake Malawi National Park by J. Todd Streelman, S.L. Gymrek, M.R. Kidd, C. Kidd, R.L. Robinson, E. Hert, A.J. Ambali and T.D. Kocher, Molecular Ecology, vol 13, pp 2471-2479, 21 April 2004

Major Histocompatibility Complex Variation In Two Species Of Cichlid Fishes From Lake Malawi by Hideki Ono, Colm O'hUigin, Herbert Tichy and Jan Klein, Molecular and Evolutionary Biology, 10(5): 1060-1072 (1993)

Mitochondrial Phylogeny of the Endemic Mouthbrooding Lineages of Cichlid Fishes from Lake Tanganyika in Eastern Africa by Christian Sturmbauer and Axel Meyer, Journal of Molecular and Biological Evolution, Vol 10, No. 4, pp 751-768, 1993

Multilocus Phylogeny of Cichlid Fishes (Pisces: Perciformes) : Evolutionary Comparison of Microsatellite and Single-Copy Nuclear Loci by J. Todd Streelman, Rafael Zardoya, Axel Meyer and Stephen A Karl, Journal of Molecular and Biological Evolution, Vol 15, No 7, pp 798-808, 1998

Origin of the Superflock of Cichlid Fishes from Lake Victoria, East Africa by Erik Verheyen, Walter Salzburger, Jos Snoeks and Axel Meyer, Science, vol 300, pp 325-329, 11 April 2003

Phylogeny of African Cichlid Fishes as Revealed By Molecular Markers by Werner E. Mayer, Herbert Tichy and Jan Klein., Heredity, vol 80, pp 702-714, 1998

The Species Flocks of East African Cichlid Fishes: Recent Advances in Molecular Phylogenetics and Population Genetics by Walter Salzburger and Axel Mayer, Naturwissenschaft, vol 91, pp 277-290, 20 April 2004

[4] Speciation Events Observed In The Laboratory:

Evidence for rapid speciation following a founder event in the laboratory by J.R. Weinberg V. R. Starczak and P. Jora, Evolution vol 46, pp 1214-1220, 1992

Experimentally Created Incipient Species of Drosophila by Theodosius Dobzhansky & Olga Pavlovsky, Nature 230, pp 289 - 292 (02 April 1971)

Founder-flush speciation in Drosophila pseudoobscura: a large scale experiment by A. Galiana, A. Moya and F. J. Alaya, Evolution vol 47, pp 432-444, 1993

Sexual isolation caused by selection for positive and negative phototaxis and geotaxis in Drosophila pseudoobscura by E. del Solar, Proceedings of the National Academy of Sciences of the USA, vol 56, pp 484-487, 1966

So, that's 28 scientific papers containing evidence for evolution. These are just a tiny fraction of the papers published on the subject. In 2007 alone, over eighteen thousand critically robust peer reviewed scientific papers were published in the field of evolutionary biology. I therefore contend that unityisfact is, like all other propagandists for reality-denial masturbation-fantasy doctrines, talking out of an orifice more usually associated with a more solid form of waste.

Meanwhile, let's take a look at this:

THERE IS NO PLACE FOR RANDOMNESS IN THE DNA
RANDOMNESS IS THE BASIC PILLAR OF EVOLUTION
THERE IS NO PLACE FOR EVOLUTION


Oh look, the scientifically illiterate propagandist for masturbation-fantasy doctrine forgot selection. Why do creotards ALWAYS neglect to mention selection? Could it be because selection blows their strawman canards out of the water?

Meanwhile:

EVOLUTION CREATIONISM IS A FAIRY TALE, A STORY TOLD FROM ONE GENERATION TO ANOTHER, THAT HAS CAUSED MILLIONS TO GET INTO THE DEEP SLEEP OF IGNORANCE.


There, fixed that for you.

Oh, and by the way, with respect to insulin genes, how come insulin genes differ across various organisms in precisely the manner that would be expected from common descent with modification?. Here's some sample insulin genes and their corresponding protein sequences:

[1] Human insulin gene on Chromosome 11, which is as follows:

atg gcc ctg tgg atg cgc ctc ctg ccc ctg ctg gcg ctg ctg gcc ctc tgg gga cct gac
cca gcc gca gcc ttt gtg aac caa cac ctg tgc ggc tca cac ctg gtg gaa gct ctc tac
cta gtg tgc ggg gaa cga ggc ttc ttc tac aca ccc aag acc cgc cgg gag gca gag gac
ctg cag gtg ggg cag gtg gag ctg ggc ggg ggc cct ggt gca ggc agc ctg cag ccc ttg
gcc ctg gag ggg tcc ctg cag aag cgt ggc att gtg gaa caa tgc tgt acc agc atc tgc
tcc ctc tac cag ctg gag aac tac tgc aac tag

which codes for the following protein sequence (using the standard single letter mnemonics for individual amino acids:

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKT
RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQ]KR
GIVEQCCTSICSLYQLENYCN

Now, I refer everyone to this data, which is the coding sequence for insulin in the Lowland Gorilla (differences are highlighted in boldface):

atg gcc ctg tgg atg cgc ctc ctg ccc ctg ctg gcg ctg ctg gcc ctc tgg gga cct gac
cca gcc gcg gcc ttt gtg aac caa cac ctg tgc ggc tcc cac ctg gtg gaa gct ctc tac
cta gtg tgc ggg gaa cga ggc ttc ttc tac aca ccc aag acc cgc cgg gag gca gag gac
ctg cag gtg ggg cag gtg gag ctg ggc ggg ggc cct ggt gca ggc agc ctg cag ccc ttg
gcc ctg gag ggg tcc ctg cag aag cgt ggc atc gtg gaa cag tgc tgt acc agc atc tgc
tcc ctc tac cag ctg gag aac tac tgc aac tag

this codes for the protein sequence:

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKT
RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR
GIVEQCCTSICSLYQLENYCN

which so happens to be the same precursor protein. However, Gorillas are closely related to humans. Let's move a little further away, to the domestic cow, Bos taurus (whose sequence is found here):

atg gcc ctg tgg aca cgc ctg cgg ccc ctg ctg gcc ctg ctg gcg ctc tgg ccc ccc ccc
ccg gcc cgc gcc ttc gtc aac cag cat ctg tgt ggc tcc cac ctg gtg gag gcg ctg tac
ctg gtg tgc gga gag cgc ggc ttc ttc tac acg ccc aag gcc cgc cgg gag gtg gag ggc
ccg cag gtg ggg gcg ctg gag ctg gcc gga ggc ccg ggc gcg ggc ggc ctg gag ggg ccc
ccg cag aag cgt ggc atc gtg gag cag tgc tgt gcc agc gtc tgc tcg ctc tac cag ctg
gag aac tac tgt aac tag

Already this is a smaller sequence - 318 codons instead of 333 - so we KNOW we're going to get a different insulin molecule with this species ... which is as follows:

MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPK
ARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVE
QCCASVCSLYQLENYCN

clearly a different protein, but one which still functions as an insulin precursor and results in a mature insulin molecule in cows, one which differs in exact sequence from that in humans.

Moving on again, we have a different coding sequence from the tropical Zebrafish, Danio rerio, (sequence to be found here) which is as follows:

atg gca gtg tgg ctt cag gct ggt gct ctg ttg gtc ctg ttg gtc gtg tcc agt gta agc
act aac cca ggc aca ccg cag cac ctg tgt gga tct cat ctg gtc gat gcc ctt tat ctg
gtc tgt ggc cca aca ggc ttc ttc tac aac ccc aag aga gac gtt gag ccc ctt ctg ggt
ttc ctt cct cct aaa tct gcc cag gaa act gag gtg gct gac ttt gca ttt aaa gat cat
gcc gag ctg ata agg aag aga ggc att gta gag cag tgc tgc cac aaa ccc tgc agc atc
ttt gag ctg cag aac tac tgt aac tga

And this sequence codes for the following protein:

MAVWLQAGALLVLLVVSSVSTNPGTPQHLCGSHLVDALYLVCGPTFTGFFYNP
KRDVEPLLGFLPPKSAQETEVADFAFKDHAELIRK
RGIVEQCCHKPCSIFELQNYCN

so again we have a different insulin precursor protein that is ultimately converted into a different insulin molecule within the Zebra Fish.

So, let's nail the One True Sequence™ fallacy before it is even erected, shall we?

What is selected for is function. ANY protein sequence that functions properly will be selected for. And this is precisely what has happened in the case of the insulin gene. The fun part being, of course, that these insulin molecules ALL work, and indeed can be used in different species. Bovine insulin was used for many years to treat human diabetes until the recombinant technology to manufacture pure human insulin was devised.

Oh and I see "Clearmind", aka Wooter, has joined the tardfest. They're crawling out of the woodwork tonight aren't they?

Oh by the way, with respect to the mind, neuroscientists are increasingly alighting upon evidence that the mind is an emergent property of the brain. But since unityisfact is too busy filling his head with masturbation-fantasy creationist garbage, he probably wouldn't recognise the valid science if it piloted an AH-64D Longbow Apache gunship and shot a Hellfire missile at his testicles.

Oh, and the tard about speciation being unable to happen that unityisfact posted thus:

However, no matter how long this process goes on, it will not transform those deer into another species. The weak deer are eliminated, the strong survive, but, since no alteration in their genetic data takes place, no transformation of a species occurs. Despite the continuous processes of selection, deer continue to exist as deer.


Is directly refuted by the existence of documented speciation events in the scientific literature including speciation events observed in the laboratory. Game over.

Oh, and as for the Cambrian Explosion nonsense, let's look at some more scientific papers shall we?

Can fast early rates reconcile molecular dates with the Cambrian explosion? by L.D. Bromham & M.D. Hendry, Proc. R. Soc. Lond. B 267: 1041-1047 (2000)

Estimating Metazoan Divergence Times With A Molecular Clock by Kevin J. Peterson, Jessica B. Lyons, Kristin S. Nowak, Carter M. Takacs, Matthew J. Wargo & Mark A. McPeek, Proceedings of the National Academy of Science of America, April 2004, 101, 17, 6536-6541

Evolution of Amino Acid Frequencies in Proteins Over Deep Time: Inferred Order of Introduction of Amino Acids into the Genetic Code by Dawn J. Brooks, Jacques R. Fresco, Arthur M. Lesk, and Mona Singh, Molecular Biology and Evolution 19: 1645-1655 (2002)

Fossils, Molecules And Embryos: New Perspectives On The Cambrian Explosion by J.W. Valentine, D. Jablonski & D.H. Erwin, Development, February 1998, 126(5): 851-859

Inferring The Historical Patterns Of Biological Evolution by Mark Pagel, Nature, 401: 877-884 (28 October 1999)

Interpreting the Earliest Metazoan Fossils: What Can We Learn? by Ben Waggoner, Amer. Zool., 38: 975-982

Molecular Phylogeny of Arthropods and the Significance of the Cambrian "Explosion" for Molecular Systematics by Jerome C. Regier & Jeffrey W. Schultz, AMER. ZOOL., 38: 918-928 (1998)

Precambrian Sponges with Cellular Structures by Chia-Wen Li, Jun-Yan Chen and Tzu-En Hua, SCIENCE 279(6) February 1998

Quality of the fossil record thorugh time by M.J. Benton, M.A. Wills and R. Hitchin, Nature, 403: 534-537 (3 Feb 2000)

Sr and C isotopes in Lower Cambrian carbonates from the Siberian craton: A paleoenvironmental record during the 'Cambrian explosion' by L.A. Derry, M.D. Brasier, R. M. Corfield, A. Yu. Rozanov & A. Yu. Zhuralev, Earth and Planetary Science Letters 128: 671-681 (1994)

Taxonomic Congruence Versus Total Evidence, and Amniote Phylogeny Inferred from Fossils, Molecules and Morphology by Douglas J. Eernisse and Arnold G. Kluge, Molecular Biology & Evolution, 10(6): 1170-1195 (1993)

Testing the Cambrian explosion hypothesis by using a molecular dating technique by Lindell Bromham, Andrew Rambaut, Richard Fortey, Alan Cooper and David Penny, Proceedings of the National Academy of Science of America, October 1998, 95: 12386-12389

The Cambrian "Explosion": Slow Fuse Or Megatonnage? by Simon Conway Morris, Proceedings of the National Academy of Science of America, April 2000, 97(9): 4426-4429

The Ediacaran Biotas in Space and Time by Ben Waggoner, Integrative & Comparative Biology, 43: 104-113 (2003)

The Timing Of Eukaryotic Evolution: Does A Relaxed Molecular Clock Reconcile Proteins And fossils? by Emmanuel J.P. Douzery, Elizabeth A. Snell, Eric Bapteste, Frédéric Delsuc & Hervé Philiipe, Proceedings of the National Academy of Science of America, October 2004, 101, 43, 15386-15391

First of all, the minimum time scale posited for this event is 18 to 23 million years. This is before we take account of the fact that there exist Precambrian fossils that extend the timeline of phylogenesis considerably. One of these fossils I covered here, which is, wait for it, a multicellular eukaryote that is 1,200 million years old and therefore predates the Cambrian by 700 million years. The paper describing it is this one:

Bangiomorpha pubescens n. gen., n. sp.: implications for the evolution of sex, multicellularity, and the Mesoproterozoic/Neoproterozoic radiation of eukaryotes by Nicholas J. Butterfield, Palaeobiology, 26(3): 386-404, September 2000

The abstract can be found here, and I shall quote it in full below:

Multicellular filaments from the ca. 1200-Ma Hunting Formation (Somerset Island, arctic Canada) are identified as bangiacean red algae on the basis of diagnostic cell-division patterns. As the oldest taxonomically resolved eukaryote on record Bangiomorpha pubescens n. gen. n. sp. provides a key datum point for constraining protistan phylogeny. Combined with an increasingly resolved record of other Proterozoic eukaryotes, these fossils mark the onset of a major protistan radiation near the Mesoproterozoic/Neoproterozoic boundary.

Differential spore/gamete formation shows Bangiomorpha pubescens to have been sexually reproducing, the oldest reported occurrence in the fossil record. Sex was critical for the subsequent success of eukaryotes, not so much for the advantages of genetic recombination, but because it allowed for complex multicellularity. The selective advantages of complex multicellularity are considered sufficient for it to have arisen immediately following the appearance of sexual reproduction. As such, the most reliable proxy for the first appearance of sex will be the first stratigraphic occurrence of complex multicellularity.

Bangiomorpha pubescens is the first occurrence of complex multicellularity in the fossil record. A differentiated basal holdfast structure allowed for positive substrate attachment and thus the selective advantages of vertical orientation; i.e., an early example of ecological tiering. More generally, eukaryotic multicellularity is the innovation that established organismal morphology as a significant factor in the evolutionary process. As complex eukaryotes modified, and created entirely novel, environments, their inherent capacity for reciprocal morphological adaptation, gave rise to the "biological environment" of directional evolution and "progress." The evolution of sex, as a proximal cause of complex multicellularity, may thus account for the Mesoproterozoic/Neoproterozoic radiation of eukaryotes.


So already we're pushing back the time scale for various steps along the process. Looks like it's canard busting time once again.

Plus, as this page mentions, scientists have in their possession no less than eighteen excellent specimens of a Precambrian chordate. Here's a picture of one of the fossils:

Ediacaran Chordate

Here's a photo showing some of the sketches produced by the scientists reconstructing the original animal:

Reconstruction Work

Oddly enough, the Panda's Thumb article I've just cited also references the scientific paper by Douzery et al (2004) above that I included in my list of papers. Here's the abstract:

The use of nucleotide and amino acid sequences allows improved understanding of the timing of evolutionary events of life on earth. Molecular estimates of divergence times are, however, controversial and are generally much more ancient than suggested by the fossil record. The limited number of genes and species explored and pervasive variations in evolutionary rates are the most likely sources of such discrepancies. Here we compared concatenated amino acid sequences of 129 proteins from 36 eukaryotes to determine the divergence times of several major clades, including animals, fungi, plants, and various protists. Due to significant variations in their evolutionary rates, and to handle the uncertainty of the fossil record, we used a Bayesian relaxed molecular clock simultaneously calibrated by six paleontological constraints. We show that, according to 95% credibility intervals, the eukaryotic kingdoms diversified 950â€"1,259 million years ago (Mya), animals diverged from choanoflagellates 761â€"957 Mya, and the debated age of the split between protostomes and deuterostomes occurred 642â€"761 Mya. The divergence times appeared to be robust with respect to prior assumptions and paleontological calibrations. Interestingly, these relaxed clock time estimates are much more recent than those obtained under the assumption of a global molecular clock, yet bilaterian diversification appears to be ~100 million years more ancient than the Cambrian boundary.


Oh, and that paper also cites how the authors subjected their Bayesian analysis to a reliability test in order to reinforce the robustness of their conclusions. :)

I think I'm done here for the day. :)

Tue, 08 Jul 2008 04:31:00 UTC | #195654

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 152 by Calilasseia

So evolution cannot explain the Bombardier beetle?

Oh look. Scientific papers exist on that very subject.

Here's one I just found:

Spray mechanism of the most primitive bombardier beetle (Metrius contractus) by T Eisner, DJ Aneshansley, M Eisner, AB Attygalle, DW Alsop and J Meinwald, Journal of Experimental Biology, 203: 1265-1275, 2000

Here's the abstract:

The bombardier beetle Metrius contractus discharges its defensive secretion as a froth that clings to its body. When attacked from the rear, it allows the froth to build up over the gland openings near the abdominal tip; when attacked from the front, it conveys the secretion forwards along special elytral tracks. M. contractus has two-chambered defensive glands typical of bombardier beetles, and its secretion, like that of other bombardiers, is quinonoid and hot. Its frothing mechanism, however, is unique for bombardiers and possibly illustrative of the ancestral glandular discharge mechanism of these beetles. M. contractus, thus, could be the least derived of extant bombardiers.


Oh look. A primitive Bombardier beetle illustrating one of the intermediate stages.

Real science wins again.

Oh, Ertu, since it's obvious that you're completely ignorant of REAL SCIENCE, just answer that simple question again. Why should I believe some moron who cannot tell a living insect apart from a fishing lure?

Mon, 07 Jul 2008 19:39:00 UTC | #195451

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 140 by Calilasseia

Going to answer that question I posed Ertu?

Namely why should I believe someone who can't tell the difference between a LIVING INSECT and a FISHING LURE?

Or are you going to spam this comments page with yet more worthless blind assertion borne of scientific ignorance and a complete inability to recognise that your beloved doctrine is nothing more than a masturbation fantasy? And, for good measure, post DISHONEST QUOTE MINES such as the one you posted above from Charles Darwin, which I've just EXPOSED as a dishonest quote mine?

Mon, 07 Jul 2008 19:24:00 UTC | #195435

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 135 by Calilasseia

OI! ERTU!

WHY SHOULD I BELIEVE SOMEONE WHO CAN'T TELL THE DIFFERENCE BETWEEN A LIVING INSECT AND A FISHING LURE?

Mon, 07 Jul 2008 19:17:00 UTC | #195429

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 131 by Calilasseia

Oh look - QUOTE MINE TIME!

Here's what Darwin said in full from that passage. Notice the large chunk of text that was missing from Ertu's BLATANTLY DISHONEST QUOTE MINE ...

To suppose that the eye with all its inimitable contrivances for adjusting the focus to different distances, for admitting different amounts of light, and for the correction of spherical and chromatic aberration, could have been formed by natural selection, seems, I freely confess, absurd in the highest degree. When it was first said that the sun stood still and the world turned round, the common sense of mankind declared the doctrine false; but the old saying of Vox populi, vox Dei, as every philosopher knows, cannot be trusted in science. Reason tells me, that if numerous gradations from a simple and imperfect eye to one complex and perfect can be shown to exist, each grade being useful to its possessor, as is certainly the case; if further, the eye ever varies and the variations be inherited, as is likewise certainly the case; and if such variations should be useful to any animal under changing conditions of life, then the difficulty of believing that a perfect and complex eye could be formed by natural selection, though insuperable by our imagination, should not be considered as subversive of the theory. How a nerve comes to be sensitive to light, hardly concerns us more than how life itself originated; but I may remark that, as some of the lowest organisms, in which nerves cannot be detected, are capable of perceiving light, it does not seem impossible that certain sensitive elements in their sarcode should become aggregated and developed into nerves, endowed with this special sensibility.


Boldface emphasis in above mine.

So, Ertu, care to answer that question I posed above?

Namely, why should we consider a theory promulgated by a man who posts pictures of FISHING LURES and labels them as REAL LIVING ORGANISMS, to be anything other than a worthless masturbation fantasy?

Mon, 07 Jul 2008 19:13:00 UTC | #195425

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 122 by Calilasseia

Ertu, take a look at this:

http://forbiddenmusic.files.wordpress.com/2008/01/yahya_lure.jpg

This is a photo from Harun Yahya's worthless book. Notice the BLOODY HUGE HOOK STICKING OUT OF THE ARSE END?

Harun Yahya claimed that this was a REAL CADDIS FLY.

Tell me, where on the planet can I find LIVING CADDIS FLIES with METAL HOOKS STICKING OUT OF THEIR ARSE ENDS?

Now, if this is the sort of nonsense that is associated with creationism, why should anyone with a minimum of ten functioning brain cells regard creationism as anything other than a masturbation fantasy?

Mon, 07 Jul 2008 19:06:00 UTC | #195414

Go to: [UPDATED] Venomous Snakes, Slippery Eels and Harun Yahya

Calilasseia's Avatar Jump to comment 118 by Calilasseia

Ertu, if your Allah is so powerful, why did your Allah arrange for Harun Yahya to be such an incompetent moron when disseminating this tome of his? You know, such as using a photograph of a fishing lure with a bloody great metal hook sticking out of its arse end and claiming that it was a real Caddis Fly?

Your Allah fucked up regally there didn't he?

Just as it seems he fucked up regally arranging for all the people with functioning brain cells to be people who accepted the validity of evolutionary science, while all the retarded dickheads believe in creationist masturbation fantasies.

Mon, 07 Jul 2008 19:02:00 UTC | #195410